PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00069.75
Common NameAMTR_s00069p00112440, LOC18447736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 677aa    MW: 76512.1 Da    PI: 5.0322
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00069.75genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS432.33.6e-1322926551373
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                              lv+lL++c ea++s++++l++++L+rl elasp+g++++R++ayfteAL  r+++ ++++++ +p +++ 
  evm_27.model.AmTr_v1.0_scaffold00069.75 292 LVSLLVSCTEAITSKNFTLISQFLSRLGELASPEGTSIHRVVAYFTEALTLRVFKLWPHIFHLFPLQSDF 361
                                              689***********************************************************99888776 PP

                                     GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp 140
                                                ++++++  ++l++++ Pi+kf h+taN++Il+a+eg+++vHiiDfdi+qGlQWp L+q+La+Rp++p 
  evm_27.model.AmTr_v1.0_scaffold00069.75 362 --SEDDSAIGFRLLNQMNPIPKFMHFTANEMILRAFEGKDQVHIIDFDIKQGLQWPGLFQSLATRPNPPS 429
                                              ..478888899*********************************************************** PP

                                     GRAS 141 slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlql 210
                                              ++RiTg+g+    sk+el+etgerLa fAe+++++fef++ v+++led++l++L+vk+gE+++Vn++lql
  evm_27.model.AmTr_v1.0_scaffold00069.75 430 HVRITGIGE----SKHELQETGERLAGFAEAMNLKFEFHA-VVDKLEDVRLWMLHVKEGESVVVNCILQL 494
                                              *********....9**************************.7**************************** PP

                                     GRAS 211 hrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                                              h++l ++   +   +++L l++s++P +vv++eqea+hn++++  rfl++l+yysa+fds++a++pr+s 
  evm_27.model.AmTr_v1.0_scaffold00069.75 495 HTVLYDDNVGA--LRDLLGLMQSTRPVMVVIAEQEASHNDPNWELRFLRTLKYYSAIFDSIDASFPRDSP 562
                                              ***96554433..589****************************************************** PP

                                     GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                                              +rikvE++ ++rei+n+vaceg+er+erhe++e+W++ +ee+GF++++++e++  q +++l++++ d y+
  evm_27.model.AmTr_v1.0_scaffold00069.75 563 ARIKVEEM-FAREIRNIVACEGRERTERHESFETWKRLMEEVGFRSLRVEERERLQSQMILKMYDCDSYN 631
                                              ********.********************************************************99999 PP

                                     GRAS 351 veee.sgslvlgWkdrpLvsvSaW 373
                                              v ++ ++ l+l+W d+pL++vS+W
  evm_27.model.AmTr_v1.0_scaffold00069.75 632 VVKQgEEGLTLCWLDQPLFTVSSW 655
                                              9877366777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.861266635IPR005202Transcription factor GRAS
PfamPF035141.2E-129292655IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MLAGCSALLS PRHRLRTDSG EQFHSIQTQQ KQSCHFQIQD KLYVSQHSSN SMSTQRLDLP  60
CSFSRKEVPR SQPLIESSTT CSLRRNARIP APITSGFRPK AADYNKIEVS ETFWERGKSL  120
KRFCDQNPAE DFSTSRAKRI RGEEKLSLSQ LGHDDFCFSE NVKPESIGLS PGFESFDPPV  180
SFSPPSIEEE GVYSYTKPES ILSPLPLAKT SAWVESIVTE VLEKGDNKDG ETSEEPKKSK  240
TSSSSSETES LTHKEENKSP EKDTGEGTSV PYQPEEAPES SENLEREQGL ELVSLLVSCT  300
EAITSKNFTL ISQFLSRLGE LASPEGTSIH RVVAYFTEAL TLRVFKLWPH IFHLFPLQSD  360
FSEDDSAIGF RLLNQMNPIP KFMHFTANEM ILRAFEGKDQ VHIIDFDIKQ GLQWPGLFQS  420
LATRPNPPSH VRITGIGESK HELQETGERL AGFAEAMNLK FEFHAVVDKL EDVRLWMLHV  480
KEGESVVVNC ILQLHTVLYD DNVGALRDLL GLMQSTRPVM VVIAEQEASH NDPNWELRFL  540
RTLKYYSAIF DSIDASFPRD SPARIKVEEM FAREIRNIVA CEGRERTERH ESFETWKRLM  600
EEVGFRSLRV EERERLQSQM ILKMYDCDSY NVVKQGEEGL TLCWLDQPLF TVSSWAPIDV  660
AGSSSSFSQP GGEIEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-7528765713379Protein SCARECROW
5b3h_D5e-7528765713379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857885.10.0scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLU5DD520.0U5DD52_AMBTC; Uncharacterized protein
STRINGERN193520.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55071521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-180GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]