PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00069.29
Common NameAMTR_s00069p00049300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 197aa    MW: 21237.5 Da    PI: 8.6955
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00069.29genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82.1e-373696262
                                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                             k+kal+cprC+s+ntkfCyynnyslsqPryfC+aC+r+Wt+GG+lrnvPvGg++rk kk s
  evm_27.model.AmTr_v1.0_scaffold00069.29 36 KDKALNCPRCNSSNTKFCYYNNYSLSQPRYFCRACKRHWTEGGTLRNVPVGGSSRKPKKPS 96
                                             7899****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-243287IPR003851Zinc finger, Dof-type
PfamPF027011.5E-333794IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.7924094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MKAVEGDPWK KPIEEEPELT PSPSSSSSSA KARPQKDKAL NCPRCNSSNT KFCYYNNYSL  60
SQPRYFCRAC KRHWTEGGTL RNVPVGGSSR KPKKPSSSSS SSRKFNETLI SQETQGPNLP  120
VLPLDGGSSI TNASYFPGFE MNNYLGLGPY SLQDANSLDL SFSIGEGPNM ENMGGFWSGF  180
NGGGGAWSAQ LPNYGP*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857839.21e-141dof zinc finger protein DOF4.6
SwissprotQ8LAP81e-33DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLU5D0Z61e-140U5D0Z6_AMBTC; Uncharacterized protein
STRINGERN193061e-141(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-32Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]