PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00067.108
Common NameAMTR_s00067p00126920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 99aa    MW: 11151.7 Da    PI: 6.7161
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00067.108genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260415.4e-1315646101
                                    DUF260  46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                                               ++++p ++r++a++++v+eA+ r +dPv+G+v  i+kl +q++ ++++la++k++l
  evm_27.model.AmTr_v1.0_scaffold00067.108   1 MQKVPIDKRSEAAECMVFEAHSREQDPVHGCVHQISKLFHQISLAQQDLAMVKAQL 56 
                                               5789999********************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.09156IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-11153IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MQKVPIDKRS EAAECMVFEA HSREQDPVHG CVHQISKLFH QISLAQQDLA MVKAQLAILK  60
AQHFQQQIQQ QQHASSLSEL YNLHHSLTEF ISIPDLAP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLU5DEK82e-63U5DEK8_AMBTC; Uncharacterized protein
STRINGERN188434e-64(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-11LBD family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]