PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00066.82
Common NameAMTR_s00066p00100930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CO-like
Protein Properties Length: 480aa    MW: 52370 Da    PI: 4.5767
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00066.82genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52.1e-0659101541
                                 zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                                               C+ ++ +++  +C+ +   lC +C  + H+       H++v 
  evm_27.model.AmTr_v1.0_scaffold00066.82  59 LCDFCGVQNAVVYCRPDAARLCLTCDRNVHSAnalssrHNRVL 101
                                              7*****999*********************6688888898876 PP

2zf-B_box20.68.9e-07100129332
                                 zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClle 32 
                                                +C+ +++++++  C+d+++ lC+ C  +
  evm_27.model.AmTr_v1.0_scaffold00066.82 100 VLICEACSSHPATVRCFDDKVSLCQACDWN 129
                                              679************************865 PP

3CCT64.14.3e-22422465144
                                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                              R+ a++RYkeK+k+Rk+eK+irY+sRKa+A+ R+RvKGrFvk+ 
  evm_27.model.AmTr_v1.0_scaffold00066.82 422 RDSAMMRYKEKKKNRKYEKQIRYASRKARADIRKRVKGRFVKAG 465
                                              899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.62755102IPR000315B-box-type zinc finger
SMARTSM003368.3E-1355102IPR000315B-box-type zinc finger
CDDcd000212.20E-559102No hitNo description
CDDcd000210.00218102144No hitNo description
SMARTSM003363103144IPR000315B-box-type zinc finger
PROSITE profilePS5101715.12422464IPR010402CCT domain
PfamPF062033.3E-16422464IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSSSIHLING ERRLPSFCLC FEHCLDELDW NLDFERQVNS GFENSKSSPG FGVRTMDSLC  60
DFCGVQNAVV YCRPDAARLC LTCDRNVHSA NALSSRHNRV LICEACSSHP ATVRCFDDKV  120
SLCQACDWNG FGCSMASGHN RQSLNGYSGC PSPSQIWSCV LDGSSANSHC LMTTINENGE  180
SNDCWEGEGN GGLIGLAGQS RIQELDNGNK CDLWMHASSA TSGSNPAPFR EEQQLEGRNE  240
SNESKHGCPQ LKDTDFCDGD DLCEVLGISD DALNLENCGE LFDGSESLIK DVFEDTTIDC  300
FFMENNFSVA DSNGQSDIAI EASSTAQQDC MTLPSMQFVG TPRSIQATTT CSATNQVISN  360
PCSNSNSVNL GFPVRQFFSS ISLPLSGLTT GDNTGSDYQD CGVSPSPVMF IGDLEPQCPQ  420
ARDSAMMRYK EKKKNRKYEK QIRYASRKAR ADIRKRVKGR FVKAGEVYDY DPLNATTGC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020531875.10.0putative zinc finger protein CONSTANS-LIKE 11 isoform X1
TrEMBLU5D3J80.0U5D3J8_AMBTC; Uncharacterized protein
STRINGERN201660.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.13e-58B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]