PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00066.144
Common NameAMTR_s00066p00143040, LOC18448638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 267aa    MW: 30241.1 Da    PI: 8.288
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00066.144genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-18140194256
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00066.144 140 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLTLAKQLNLRPRQVEVWFQNRRARTK 194
                                               788899***********************************************98 PP

2HD-ZIP_I/II127.36.8e-41140230192
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+
  evm_27.model.AmTr_v1.0_scaffold00066.144 140 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLTLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRC 208
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreelk 92 
                                               +++l+een+rL+kev eLr +lk
  evm_27.model.AmTr_v1.0_scaffold00066.144 209 CENLTEENRRLQKEVMELR-SLK 230
                                               ******************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.3E-102120IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.3E-18113197IPR009057Homeodomain-like
SuperFamilySSF466892.01E-18130197IPR009057Homeodomain-like
PROSITE profilePS5007117.313136196IPR001356Homeobox domain
SMARTSM003896.4E-16138200IPR001356Homeobox domain
PfamPF000467.6E-16140194IPR001356Homeobox domain
CDDcd000863.58E-15140197No hitNo description
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PfamPF021832.6E-11196231IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.9E-24196239IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009733Biological Processresponse to auxin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MNREDLNLSL SLRRVGDFEL NLLPRNCRND SSSLDRSETA RSILKSFDVN RIQATSDRIP  60
TTTDAIRSEI SRIPATPNMA GFDVNRIPVI SECEEEAVVS SPMSTVSSLS MSGGKRDEPE  120
GERASSRGSS DEEDGGEAAR KKLRLSKDQS AVLEESFKEH NTLNPKQKLT LAKQLNLRPR  180
QVEVWFQNRR ARTKLKQTEV DCEFLKRCCE NLTEENRRLQ KEVMELRSLK QTPHFYMHVP  240
PAALTMCPSC ERVAVSESQF RPQIRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188196RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858761.10.0homeobox-leucine zipper protein ATHB-4
SwissprotP466011e-77HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLU5DI270.0U5DI27_AMBTC; Uncharacterized protein
STRINGERN202280.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.13e-67homeobox-leucine zipper protein 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]