PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00060.27
Common NameAMTR_s00060p00077350, LOC18423753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GeBP
Protein Properties Length: 226aa    MW: 25817.7 Da    PI: 10.4086
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00060.27genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57375.97.1e-2433128297
                                   DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkk 71 
                                               fqrlw  +Dei +Lq l+ + +++g++   d+  fy+ v++s+   ++k ql+eK+rrLKkKf++ +++
  evm_27.model.AmTr_v1.0_scaffold00060.27  33 SFQRLWCPQDEIRFLQLLLRC-TSQGMHFPRDMPLFYHRVSHSLTQSYTKPQLSEKLRRLKKKFRRTSSR 101
                                              79*******************.678999999*************************************** PP

                                   DUF573  72 aksgk.epsfskehdqkifelskkiWg 97 
                                              +++++  ++  ++h++  f++sk++W 
  evm_27.model.AmTr_v1.0_scaffold00060.27 102 IARDNaAVAAMTPHERRLFGMSKRLWS 128
                                              776651567889**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-2534128IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MATPSDSQKL PVKRKLEPLD PPQQQPSPSA TKSFQRLWCP QDEIRFLQLL LRCTSQGMHF  60
PRDMPLFYHR VSHSLTQSYT KPQLSEKLRR LKKKFRRTSS RIARDNAAVA AMTPHERRLF  120
GMSKRLWSGD QPTVMGPAAG VWRAVAEAFE EGVEEARASI QSRYCGVVYP RASFGPLGWM  180
EFTDAAAELQ RRWGEQRVAE MEVFSQRLKL VLERVGSELN EAELI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18896RRLKKKFRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006828413.11e-166uncharacterized protein LOC18423753
TrEMBLW1NKR91e-164W1NKR9_AMBTC; Uncharacterized protein
STRINGERM958291e-165(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9800912
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]