PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00059.65
Common NameAMTR_s00059p00091580, LOC18445865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 500aa    MW: 53920.6 Da    PI: 5.9899
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.65genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS260.94.4e-801584973374
                                     GRAS   3 elLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              e+L+++A+ ++ g+ ++aqa+Larl+++   + g+p qR+ + f+eAL   l        +  +p +  +
  evm_27.model.AmTr_v1.0_scaffold00059.65 158 EQLVRVAQSLEGGNVAMAQAILARLNHTlPPSVGRPHQRALFQFKEALCGLLGP------H--APAPMLP 219
                                              79*************************9566667****************9999......3..3333334 PP

                                     GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpps 141
                                               + ++++ a+k+fse+ P+ +fs++taNqa+lea+eg+ +v +iD+d++ G+QW++L+q+La Rp+gpp 
  evm_27.model.AmTr_v1.0_scaffold00059.65 220 LDIVHKIGAYKAFSEAIPLTQFSNFTANQALLEAFEGAPAVWVIDLDMGLGGQWASLMQELAHRPGGPPA 289
                                              469******************************************************************* PP

                                     GRAS 142 lRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlh 211
                                              +R+T++g+       e+   +e+L++fA+elg+ fefn+       +  le L  ++gEa+ V +   + 
  evm_27.model.AmTr_v1.0_scaffold00059.65 290 MRLTAIGE----LGFEMGLARENLRHFARELGLVFEFNI-------ASGLEGLCASNGEAIGVMVGAGMP 348
                                              ********....99************************9.......3456889999*******9988665 PP

                                     GRAS 212 rlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                                                             v + v++l P+vv vve e  + ++s+ +r+++ ++yy++l++slea+ +  +  
  evm_27.model.AmTr_v1.0_scaffold00059.65 349 PSS-----------PVARSVRRLGPRVVAVVEAENGRAEASLSRRLTRGIQYYTSLMESLEAS-AIGNVV 406
                                              553...........47789*******************************************9.688999 PP

                                     GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                                              ++ +Er ++++ i+  v  + +      ++ ++Wre++  aGF+ + l++++++qa++l+++++++g++v
  evm_27.model.AmTr_v1.0_scaffold00059.65 407 ERGIERLIMRPGIEASVVGAPR--STCGTSTASWREAMAGAGFSVAGLTNFTETQAQCLVERTQVRGFHV 474
                                              999************9986555..5888889*************************************** PP

                                     GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                                              e++ ++lvl+W++rpLv++SaWr
  evm_27.model.AmTr_v1.0_scaffold00059.65 475 EKRGAALVLCWQRRPLVAASAWR 497
                                              **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.015130477IPR005202Transcription factor GRAS
PfamPF035141.5E-77158497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MNPLLSIAQH HQAHPPHPAC APALEPTSVL DLRSSPTPAP PLWAQQQPPP MEEWDSLLLD  60
EPSLMRWIMG GEIDETGNPS SLSRPQFAST EPAPVEPVYP IDPFSFPSIE PTATFSSLPF  120
VAANNPHFDQ FGFEREQVYS GHHHQSGGLV ANDEWWLEQL VRVAQSLEGG NVAMAQAILA  180
RLNHTLPPSV GRPHQRALFQ FKEALCGLLG PHAPAPMLPL DIVHKIGAYK AFSEAIPLTQ  240
FSNFTANQAL LEAFEGAPAV WVIDLDMGLG GQWASLMQEL AHRPGGPPAM RLTAIGELGF  300
EMGLARENLR HFARELGLVF EFNIASGLEG LCASNGEAIG VMVGAGMPPS SPVARSVRRL  360
GPRVVAVVEA ENGRAEASLS RRLTRGIQYY TSLMESLEAS AIGNVVERGI ERLIMRPGIE  420
ASVVGAPRST CGTSTASWRE AMAGAGFSVA GLTNFTETQA QCLVERTQVR GFHVEKRGAA  480
LVLCWQRRPL VAASAWRCC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-3616249624377Protein SCARECROW
5b3h_D2e-3616249624377Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856053.10.0scarecrow-like protein 6
TrEMBLU5D5N80.0U5D5N8_AMBTC; Uncharacterized protein
STRINGERN175200.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP17501242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.13e-79GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]