PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00059.32
Common NameAMTR_s00059p00051820, LOC18445829
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 627aa    MW: 68071.1 Da    PI: 5.2065
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.32genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.86.3e-1022706264374
                                     GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                                               L+++A+ v+s d   a a La+l+  a  +g+p++Rl++yf+eAL +rl           p+ + s   
  evm_27.model.AmTr_v1.0_scaffold00059.32 270 SLVDAARTVHS-DPGHAAASLAELRRSAPDSGSPTERLVSYFAEALIERLDP------TGHPVAQFS--- 329
                                              57888888887.77889999*******************************9......334555555... PP

                                     GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.sl 142
                                               +e++  +k++++++P+ kf+hltaNqaIlea+e+++ +Hi+Df+i qG+QW+aLlqaLa+Rp+g+p ++
  evm_27.model.AmTr_v1.0_scaffold00059.32 330 AEESTLCYKALNDACPFSKFAHLTANQAILEAMETADSIHIVDFGIVQGVQWAALLQALATRPAGKPaKI 399
                                              6788899********************************************************66555** PP

                                     GRAS 143 RiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlql 210
                                              Ri g+ +p+ g   + +l +tg+rL +fA+ l+++fef++ v  ++ed+   +Lr   gE +aVn++lql
  evm_27.model.AmTr_v1.0_scaffold00059.32 400 RISGIPAPSLGsnPAPSLAATGNRLCDFAKLLELNFEFSP-VPCSIEDVMEGDLRRADGEFVAVNFMLQL 468
                                              ********99988999************************.6889************************* PP

                                     GRAS 211 hrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                                              hrl+de+++      + L++ k l+Pkvv++ e e+ +n+++F+ r+++al+yy a+f++lea+++r+ +
  evm_27.model.AmTr_v1.0_scaffold00059.32 469 HRLVDEKMEKVA---RALRVAKALKPKVVTLGEYELGLNRGDFMGRLSRALRYYGAMFECLEAGMGRACK 535
                                              ****77777666...9****************************************************** PP

                                     GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgy 349
                                              er  vEr+++gr+i  +v + +     r+e+   Wre +e+aGF  + ls++a++qa++ll +++ s  y
  evm_27.model.AmTr_v1.0_scaffold00059.32 536 ERERVERVVIGRRIAGAVKNTE-----RMEERCIWREEIERAGFVGLGLSHYAVSQARMLLWNYDySSSY 600
                                              ****************998765.....5677888*******************************9999* PP

                                     GRAS 350 rveeesgslv.lgWkdrpLvsvSaWr 374
                                              ++ e    ++ l Wkd+pL++vSaWr
  evm_27.model.AmTr_v1.0_scaffold00059.32 601 SLIEAGPGFLtLAWKDQPLLTVSAWR 626
                                              99988666655**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.866241604IPR005202Transcription factor GRAS
PfamPF035142.2E-99270626IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QKQQQQQQQQ QQQINGGGNG GFALNPWSHH SGFLNPRLPN  60
DGAGFGSASA TAMGFSDGYG GGAAAVEAEP PVLIYPPLEQ ERPGGLHMWP EHRNGLRSPI  120
PFKLSDLHLQ GLSSGGAGFE GDEWMECLMG DFHGVESGGS LRSCFESGPC ESTESSELPS  180
TGEPWRADFS AIISEPPFAQ TLSPPLETKA NIISEQQQQN PNFPTATLPQ PIQPWQPEAV  240
PSAECRKPPD GRSMPPLVNR DPPPPPLLLS LVDAARTVHS DPGHAAASLA ELRRSAPDSG  300
SPTERLVSYF AEALIERLDP TGHPVAQFSA EESTLCYKAL NDACPFSKFA HLTANQAILE  360
AMETADSIHI VDFGIVQGVQ WAALLQALAT RPAGKPAKIR ISGIPAPSLG SNPAPSLAAT  420
GNRLCDFAKL LELNFEFSPV PCSIEDVMEG DLRRADGEFV AVNFMLQLHR LVDEKMEKVA  480
RALRVAKALK PKVVTLGEYE LGLNRGDFMG RLSRALRYYG AMFECLEAGM GRACKERERV  540
ERVVIGRRIA GAVKNTERME ERCIWREEIE RAGFVGLGLS HYAVSQARML LWNYDYSSSY  600
SLIEAGPGFL TLAWKDQPLL TVSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1322666263375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856020.10.0scarecrow-like protein 4 isoform X1
TrEMBLU5D7T90.0U5D7T9_AMBTC; Uncharacterized protein
STRINGERN174870.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP67991519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50650.11e-111GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]