PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00059.249
Common NameAMTR_s00059p00213350, LOC18446049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 202aa    MW: 22036.7 Da    PI: 8.0652
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.249genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.75.9e-392282262
                                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                              ++++l+cprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+P+Gg++rk  k+s
  evm_27.model.AmTr_v1.0_scaffold00059.249 22 PHEHLRCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPIGGATRKTTKRS 82
                                              67899***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-231773IPR003851Zinc finger, Dof-type
PfamPF027019.4E-332480IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9842680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MDIHHQHQQQ NQVTKPQPLD QPHEHLRCPR CDSTNTKFCY YNNYNLSQPR HFCKNCRRYW  60
TKGGALRNIP IGGATRKTTK RSSSKPKPPS KSVILPEMTP SMPEISATTA ADMFETSGEI  120
TGTFSSLLAA NGGFGGLGEP WWNGGFQRVG GFEEGGLMQG SFVRGGIGSL QEWLGGGICE  180
PWMVETEGLD ANCWSAGSGL Q*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856237.11e-150dof zinc finger protein DOF1.7
SwissprotO821553e-39DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLU5D5I81e-148U5D5I8_AMBTC; Uncharacterized protein
STRINGERN177041e-149(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-34DOF zinc finger protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]