PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.221
Common NameAMTR_s00058p00210070, LOC18434895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 265aa    MW: 29054.9 Da    PI: 8.6096
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.221genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.73.3e-401776261
                                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                              +e+alkcprCdstntkfCyynnyslsqPryfC++CrryWtkGG+lrnvPvGgg+rknkk 
  evm_27.model.AmTr_v1.0_scaffold00058.221 17 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCRTCRRYWTKGGTLRNVPVGGGCRKNKKL 76
                                              7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.6E-341975IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-262075IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4042175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MISCSRPPLE RRLRPQPEQA LKCPRCDSTN TKFCYYNNYS LSQPRYFCRT CRRYWTKGGT  60
LRNVPVGGGC RKNKKLSVKK QLDPVPQNPS IPLNHHGDMS VTDLQLSILG NPRNDNGIMA  120
TSPAKYALSL LGNPRSEVGF YGTMKPFDGL CDMGHVGGQS DPNLLMGAQS FNYPFEFSLE  180
EVNGAYGGSF SENGMSEKMG FGYRAGEGMN QVDIKSRVLN LYGGVFPKAE DSSSGVLALD  240
WQEHGLFEPG RPTCGPSVSA YPLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845019.20.0dof zinc finger protein DOF5.4
TrEMBLW1PG940.0W1PG94_AMBTC; Uncharacterized protein
STRINGERN066940.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.18e-36TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]