PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00055.148
Common NameAMTR_s00055p00209070, LOC18446719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 425aa    MW: 48647.7 Da    PI: 6.4043
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00055.148genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.41.9e-28110191286
                                  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                                               W ++e+laLi++r+em+ +++++k++k+lWe++s kmre+gf rsp++C++kw+nl k+ykk k+++++
  evm_27.model.AmTr_v1.0_scaffold00055.148 110 WAQDEILALIALRKEMDGHFNTSKSNKHLWEQISLKMREKGFDRSPNMCTDKWRNLLKEYKKAKHQDRG 178
                                               ********************************************************************9 PP

                                  trihelix  71 rtsessstcpyfdqle 86 
                                               +    s +++y+++l+
  evm_27.model.AmTr_v1.0_scaffold00055.148 179 G---GSAKVSYYKELD 191
                                               7...4556799*9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-4101172IPR009057Homeodomain-like
PROSITE profilePS500908.014102166IPR017877Myb-like domain
SMARTSM007171.8E-5106168IPR001005SANT/Myb domain
CDDcd122033.37E-28108173No hitNo description
PfamPF138378.3E-22109193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MFLTDSMFSR DSNLHDTAQN LSSKPLNPVL LRFLGFWEDR IDPMYLSDKQ RQREFYKDEP  60
RTIIMAPVTN GFRAPTMQQQ QQQQQQQMVL AESSGEDHEA KAQKKRAETW AQDEILALIA  120
LRKEMDGHFN TSKSNKHLWE QISLKMREKG FDRSPNMCTD KWRNLLKEYK KAKHQDRGGG  180
SAKVSYYKEL DDLVRERDKI VTYKSPQAKV ESYMQYSDKG LDDGAIPFGP VEGSGRSSLN  240
LERRLDHDDH PLSIAAADAV AANGVPHWNW RDVTENGDNH HPANVVGRVI LVKFGDYTRK  300
IGIDGTAEAI KEAIKSAFGL RTKRAFWLED EEGVVRSLDR DMPLGTYVLH LDQGVTIKVC  360
LCDNSDRMTV HTEEKTLYTE DDFHDFLSRR GWIGLKDLND YRTIESLDEL HPGAVYQPAR  420
VLGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A4e-44104189186DNA binding protein GT-1
2jmw_A4e-44104189186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856891.10.0trihelix transcription factor GT-1 isoform X1
SwissprotQ9FX531e-166TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLU5DD690.0U5DD69_AMBTC; Uncharacterized protein
STRINGERN183580.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-159Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]