PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00053.77
Common NameAMTR_s00053p00128820, LOC18433248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 463aa    MW: 50508.9 Da    PI: 6.5054
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00053.77genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.52.3e-127494611374
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppset 69 
                                              l++lLl+cA++v++g+  +a+ +L ++s laspdgd+mqR+ ayfteALaar ++  +++lykal++++ 
  evm_27.model.AmTr_v1.0_scaffold00053.77  49 LIQLLLSCATHVATGSIDNANLCLDHISLLASPDGDSMQRVSAYFTEALAARALKvAWPGLYKALHATNL 118
                                              689****************************************************9*********99999 PP

                                     GRAS  70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                              +    +   +a++lf++++P+lk+++l+aNqaIlea+ege+++H+iD+++++++QW+a+lqaL+ Rp+gp
  evm_27.model.AmTr_v1.0_scaffold00053.77 119 P----QPLPHARRLFFDLCPFLKLAFLLANQAILEAMEGEKMIHVIDLNATEPAQWLAFLQALSLRPGGP 184
                                              7....678899*********************************************************** PP

                                     GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                                              p++RiTgv++    ske l +t++rLa+ Ae+l+vpf+fn+ v+ +le+l++++Lr+k+gEalaV++vlq
  evm_27.model.AmTr_v1.0_scaffold00053.77 185 PHVRITGVND----SKEVLDHTASRLAEEAERLDVPFQFNP-VVATLESLDPDALRIKSGEALAVCSVLQ 249
                                              **********....***************************.7999************************ PP

                                     GRAS 210 lhrll...............................................desvsleserdevLklvk 232
                                              lh ll                                                 s+ ++ + + +L +++
  evm_27.model.AmTr_v1.0_scaffold00053.77 250 LHALLappprgcgdeasplgvrrprqqgtlgellqkeqhhpfgqspttesstTTSLYTQTRVEGLLAFLR 319
                                              ***********************************************98876666666668899****** PP

                                     GRAS 233 slsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvaceg 302
                                                sPk++v+veqea+hn+++++er++eal++y alfd+le++++r+s er+ vE++l+g+ei+++v ceg
  evm_27.model.AmTr_v1.0_scaffold00053.77 320 AASPKIMVLVEQEASHNGATLVERVVEALHFYGALFDCLESTVGRASPERRRVEKHLFGEEIKDIVGCEG 389
                                              ********************************************************************** PP

                                     GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                                              aer+erhe+le+W  rle +G+  +pls+  + qa++ ++  + +gy v ee g+++++W+drpL+svS+
  evm_27.model.AmTr_v1.0_scaffold00053.77 390 AERKERHERLERWVGRLEGCGLVRAPLSYVGVGQARRAVQAWGCEGYGVREEGGCVLMCWQDRPLFSVSS 459
                                              ********************************************************************** PP

                                     GRAS 373 Wr 374
                                              Wr
  evm_27.model.AmTr_v1.0_scaffold00053.77 460 WR 461
                                              *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.39223441IPR005202Transcription factor GRAS
PfamPF035147.8E-12549461IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MAGIAQDDGS SSVSSSPLQI FSLMSISPGL GSPYAWLRKL KSEERGLCLI QLLLSCATHV  60
ATGSIDNANL CLDHISLLAS PDGDSMQRVS AYFTEALAAR ALKVAWPGLY KALHATNLPQ  120
PLPHARRLFF DLCPFLKLAF LLANQAILEA MEGEKMIHVI DLNATEPAQW LAFLQALSLR  180
PGGPPHVRIT GVNDSKEVLD HTASRLAEEA ERLDVPFQFN PVVATLESLD PDALRIKSGE  240
ALAVCSVLQL HALLAPPPRG CGDEASPLGV RRPRQQGTLG ELLQKEQHHP FGQSPTTESS  300
TTTSLYTQTR VEGLLAFLRA ASPKIMVLVE QEASHNGATL VERVVEALHF YGALFDCLES  360
TVGRASPERR RVEKHLFGEE IKDIVGCEGA ERKERHERLE RWVGRLEGCG LVRAPLSYVG  420
VGQARRAVQA WGCEGYGVRE EGGCVLMCWQ DRPLFSVSSW RC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-64334602377Protein SCARECROW
5b3h_D7e-64334602377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843405.10.0scarecrow-like protein 3
SwissprotQ9LPR81e-179SCL3_ARATH; Scarecrow-like protein 3
TrEMBLW1PDE00.0W1PDE0_AMBTC; Uncharacterized protein
STRINGERN050800.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25641433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-174scarecrow-like 3
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  3. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  4. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]