PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.218
Common NameAMTR_s00048p00225900, LOC18443991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 308aa    MW: 36424.9 Da    PI: 8.4495
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.218genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix84.11.8e-2656137186
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               +W++qe+++ i++r e+e+++ ++k++k+lW++v++km+erg++rsp+qCk+kw+nl +ryk  ++++ 
  evm_27.model.AmTr_v1.0_scaffold00048.218  56 QWSHQETRDFIAIRAELERDFTQTKRNKTLWQAVASKMKERGYRRSPEQCKCKWKNLVNRYKGKETSDP 124
                                               7**************************************************************999998 PP

                                  trihelix  70 krtsessstcpyfdqle 86 
                                               +    s ++cp++++l+
  evm_27.model.AmTr_v1.0_scaffold00048.218 125 E----SGRQCPFYEELQ 137
                                               7....4678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.74749113IPR017877Myb-like domain
SMARTSM007170.003653115IPR001005SANT/Myb domain
CDDcd122031.66E-2555120No hitNo description
PfamPF138371.1E-2455139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMIGSAESEA LGMSIMSSLP LQLNQAAAMA REAPISIRDP VNSSGLWSKK DDRVPQWSHQ  60
ETRDFIAIRA ELERDFTQTK RNKTLWQAVA SKMKERGYRR SPEQCKCKWK NLVNRYKGKE  120
TSDPESGRQC PFYEELQAIF TERSKSLNRM LLESELGGSA SKNKMKRPLP ERSSDEFTDD  180
EEDDEEESED DRTATKGKKR KLERDRNKVG ADKSRANGIN EVLQEFFQQQ QRMEMQWREM  240
AERRAQERRM FEQEWRQSME KLERERLMLE QSYREREEQR RMREESRAEK RDQLLTTLLN  300
KLIHDGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1253135386DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854232.10.0trihelix transcription factor GT-3b isoform X2
TrEMBLU5CZV30.0U5CZV3_AMBTC; Uncharacterized protein
STRINGERN156990.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-34Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]