PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.243
Common NameAMTR_s00045p00192570, LOC18430267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family B3
Protein Properties Length: 364aa    MW: 40761 Da    PI: 6.3794
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.243genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.51e-171098197
                                              EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHH CS
                                        B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvk 70
                                              ffk+l     ++++ l++p +f++++  ++  +    +l+ + g+   vk+  + +s++ ++++GW+eFv+
  evm_27.model.AmTr_v1.0_scaffold00045.243 10 FFKIL--LGDFTEK-LRIPPEFVRRNrREI--SAENAVLKGPIGKLCYVKM--KSTSKGLFFQDGWNEFVS 73
                                              56666..5566665.9**********6333..34479**************..****************** PP

                                              HHT--TT-EEEEEE-SSSEE..EEEEE CS
                                        B3 71 angLkegDfvvFkldgrsefelvvkvf 97
                                              +n L++g+f+vF++dg+  f   v+vf
  evm_27.model.AmTr_v1.0_scaffold00045.243 74 DNSLQTGEFLVFRYDGDLHF--SVQVF 98
                                              **************997666..77766 PP

2B347.33.7e-15271361198
                                               EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHH CS
                                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWke 67 
                                               ffkv +++++++ +  ++p +fa+ h        s++++l+ + g+sW+v ++  +k g++ +++GWk+
  evm_27.model.AmTr_v1.0_scaffold00045.243 271 FFKVQMKPSSSRFA--YIPANFARLHicA-----SRKMKLRVKGGKSWKVFVN-LRKVGSCAIQTGWKD 331
                                               67777777666655..*******999432.....457***************5.55557899******* PP

                                               HHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                                        B3  68 FvkangLkegDfvvFkldgrsefelvvkvfr 98 
                                               F   n+Lk gD+++F+l   ++ e+ v++fr
  evm_27.model.AmTr_v1.0_scaffold00045.243 332 FYLGNNLKLGDICIFELLP-EKDEMIVHFFR 361
                                               ****************986.67779999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-223103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-234103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.8157101IPR003340B3 DNA binding domain
CDDcd100171.69E-20898No hitNo description
SMARTSM010192.7E-1310101IPR003340B3 DNA binding domain
PfamPF023622.0E-151098IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-19264361IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-20265361IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.266269363IPR003340B3 DNA binding domain
CDDcd100175.05E-18270361No hitNo description
PfamPF023628.2E-14271361IPR003340B3 DNA binding domain
SMARTSM010192.5E-10272362IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MASDEHKPCF FKILLGDFTE KLRIPPEFVR RNRREISAEN AVLKGPIGKL CYVKMKSTSK  60
GLFFQDGWNE FVSDNSLQTG EFLVFRYDGD LHFSVQVFGI SGCERIYASV IKTDEEKETL  120
DEEKETKETL DGEKETSNNA KENLLDDKDR GDDMQAKVEP PYGDSSGDGG KCFGGSSALN  180
HVDGFTDNSV QPNANPTSLP NILAKDDEES DDCIIISDVE IMCPDVKWSG KRNIRNSLRS  240
GSAKPKRQSL SNQNTSMASD AARSFSSSNP FFKVQMKPSS SRFAYIPANF ARLHICASRK  300
MKLRVKGGKS WKVFVNLRKV GSCAIQTGWK DFYLGNNLKL GDICIFELLP EKDEMIVHFF  360
RDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1324235619135B3 domain-containing transcription factor VRN1
4i1k_B2e-1324235619135B3 domain-containing transcription factor VRN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020520526.10.0uncharacterized protein LOC18430268
TrEMBLW1P3H30.0W1P3H3_AMBTC; Uncharacterized protein
STRINGERN021640.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-30B3 family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]