PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.196
Common NameAMTR_s00045p00167950, LOC18430220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 276aa    MW: 30384.7 Da    PI: 6.2428
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.196genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS57.23.5e-181442741128
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 
                                               l +lLl+ Ae +s+++   a++lL   +  +sp g+p+qRl+++f+ AL +++ r  +++ +  p   +
  evm_27.model.AmTr_v1.0_scaffold00045.196 144 LAHLLLSSAEKISNQQYDGAKRLLMVCEFESSPVGNPLQRLVFHFAVALWEKIER-ETGMKSHKPEYIE 211
                                               579****************************************************.3333333333333 PP

                                      GRAS  70 seknsseelaalkl....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaL 128
                                                e n+++ l+ ++      +++ P+ k+ ++ta q I  a+++++++  iD+++ +Gl+W   
  evm_27.model.AmTr_v1.0_scaffold00045.196 212 GEANEDKMLKGYHPavlaVYQAVPFAKILQFTASQVIIGALASATKIQLIDLEARKGLHWTMV 274
                                               3344444444443334459*****************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098516.23118275IPR005202Transcription factor GRAS
PfamPF035141.2E-15144274IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MLIRHTLGFH ESETLSGSSS LINTPPLSGS LNDQEKVPIA DILEPTDHGA SPKKEKAPPI  60
SLASLEILKP YSKFSRHLYG SDAVKQSTNI DTQIGGERKL STEEILRIAG QQYLTTGENL  120
SSSPKPFSFK LSDLTDEDVN NIELAHLLLS SAEKISNQQY DGAKRLLMVC EFESSPVGNP  180
LQRLVFHFAV ALWEKIERET GMKSHKPEYI EGEANEDKML KGYHPAVLAV YQAVPFAKIL  240
QFTASQVIIG ALASATKIQL IDLEARKGLH WTMVM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840442.10.0PREDICTED: DELLA protein RGA2
TrEMBLW1NWV70.0W1NWV7_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-08RGA-like 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]