PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.195
Common NameAMTR_s00045p00167910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 216aa    MW: 23856.1 Da    PI: 9.687
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.195genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS28.81.5e-09143203163
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselyka 63 
                                               l +lLl+ Ae +++++  +a++lL      +sp  +p+qRl+++f++AL++r+ r  ++ +k+
  evm_27.model.AmTr_v1.0_scaffold00045.195 143 LAHLLLSSAEKIANHEYDRAKRLLMMCGSESSPLSNPVQRLVFHFAKALRERVGR--ETGMKS 203
                                               579**************************************************99..444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.1E-7143203IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MAFLAPEEQS ESTGSSSTIN TPPHSGSLND QEMVPIADVL AQTDHGTSTN KEKPYPISLA  60
SLKILKSHRE LSRRLSGSSA VKRSTNIGRE RKLGGERKLS IEEVMRIAGG QYLTAGRNLS  120
SPSNPHSLKL FDLTTEDFNN IELAHLLLSS AEKIANHEYD RAKRLLMMCG SESSPLSNPV  180
QRLVFHFAKA LRERVGRETG MKSLKPEYIE REKQI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621963.11e-101scarecrow-like protein 23
TrEMBLW1P3F61e-155W1P3F6_AMBTC; Uncharacterized protein
STRINGERN021161e-156(Amborella trichopoda)
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]