PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.194
Common NameAMTR_s00045p00167670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 451aa    MW: 50684.8 Da    PI: 5.4978
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.194genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS76.45.3e-2412126618163
                                      GRAS  18 elaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl.. 83 
                                                +a++lL      +sp g+p+qRl+++f+ AL +++ r  ++ +k+l+p+  + +  ++e+++ ++   
  evm_27.model.AmTr_v1.0_scaffold00045.194 121 DRAKTLLMLCDFESSPVGNPVQRLVFHFADALWEKVER--ETGMKSLKPECIEGEAdVDEVFKGYHPav 187
                                               6788899999999*************************..56666665555544442666666554455 PP

                                      GRAS  84 ..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgs 149
                                                  +++ P+ k+ ++ta q I  a+++++++H iD+++  G++W   +q+L++R+  +   l+iT vg+
  evm_27.model.AmTr_v1.0_scaffold00045.194 188 laTYKAVPFAKLLQFTASQVIISALASATKIHLIDLEARTGMHWSMVMQSLSERSkYPVELLKITMVGD 256
                                               56899**************************************************555569******** PP

                                      GRAS 150 pesgskeeleetge 163
                                                   s e++eet  
  evm_27.model.AmTr_v1.0_scaffold00045.194 257 ----SGERMEETDM 266
                                               ....7777777654 PP

2GRAS133.62.1e-41268448191374
                                      GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                                                e ++++++E++ V   l l  ll ++++le+    +++++++l  +++v++e e +hns+sF++rf+e
  evm_27.model.AmTr_v1.0_scaffold00045.194 268 EELFELDREESVPVFGPLVLRALLVKPHCLEK----MIRIIRNLCLDIMVLTEVEGKHNSPSFVNRFIE 332
                                               56679999****************99999999....********************************* PP

                                      GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                                               al yysa fdsl+a + +++++r  +E  +++ + +n+v  eg+er+ r+  l +Wr  l++ GF++v+
  evm_27.model.AmTr_v1.0_scaffold00045.194 333 ALFYYSAYFDSLDAFIEAADSNRLAMEGTFMASAMRNMVVREGRERVIRNVGLDTWRLFLNREGFEEVE 401
                                               ********************************************************************* PP

                                      GRAS 329 lsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                               +se+a  qakl+++ ++ sd  ++e + ++++ gWk+ pL s+SaWr
  evm_27.model.AmTr_v1.0_scaffold00045.194 402 VSEDALYQAKLIVESYShSDSVSLEMNGKAMTVGWKGTPLHSISAWR 448
                                               *****************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.37878427IPR005202Transcription factor GRAS
PfamPF035141.8E-21121266IPR005202Transcription factor GRAS
PfamPF035147.2E-39268448IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSTSQTRNQT GSQFSDKFTH HTLGFHESET LSGSSSPINS PPISGLLNDQ EKVPIADILD  60
QTDRGTSPKK EKAYPISLAY LEILQSYSKF QRHLSGSCAV KQSTNIDTSI GGERKPSTQY  120
DRAKTLLMLC DFESSPVGNP VQRLVFHFAD ALWEKVERET GMKSLKPECI EGEADVDEVF  180
KGYHPAVLAT YKAVPFAKLL QFTASQVIIS ALASATKIHL IDLEARTGMH WSMVMQSLSE  240
RSKYPVELLK ITMVGDSGER MEETDMREEL FELDREESVP VFGPLVLRAL LVKPHCLEKM  300
IRIIRNLCLD IMVLTEVEGK HNSPSFVNRF IEALFYYSAY FDSLDAFIEA ADSNRLAMEG  360
TFMASAMRNM VVREGRERVI RNVGLDTWRL FLNREGFEEV EVSEDALYQA KLIVESYSHS  420
DSVSLEMNGK AMTVGWKGTP LHSISAWRCF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3013744836375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848950.21e-152PREDICTED: DELLA protein GAI1
TrEMBLW1P5720.0W1P572_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-40RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]