PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.193
Common NameAMTR_s00045p00167420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 499aa    MW: 55566.5 Da    PI: 5.5065
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.193genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS97.91.5e-301623192159
                                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                                +lLl+ Ae +s+++  +a++lL      +sp g+p+qRl+++f+ AL +r  r  ++ +k+l+p+  +
  evm_27.model.AmTr_v1.0_scaffold00045.193 162 ANLLLSSAEKISNQQYDRAKRLLMVCDFESSPVGNPVQRLVFHFADALWERAER--ETGMKSLKPEYIE 228
                                               689***************************************************..6666677666555 PP

                                      GRAS  71 ekn.sseelaalkl....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLas 134
                                               ++  ++++l  ++      +++ P+ k+ ++ta q I  a+++++++H+iD++   G+QW  L+q+L++
  evm_27.model.AmTr_v1.0_scaffold00045.193 229 REAdVDKALRGYHPvvlaIYQAVPFGKLVQFTASQVIIGALDSATKIHVIDLEPRTGMQWTILMQSLSE 297
                                               4443666666654456679************************************************** PP

                                      GRAS 135 Rp.egppslRiTgvgspesgskeele 159
                                               R+  +  +l+iT vg++    + ++e
  evm_27.model.AmTr_v1.0_scaffold00045.193 298 RSeYPVEHLKITMVGDS----TGKME 319
                                               **55566********93....33333 PP

2GRAS151.29.9e-47322496197374
                                      GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                                               + +E++aV   + l ++l ++++le+    +++++++l P+++v++e e +hns+sF++rf+e l yys
  evm_27.model.AmTr_v1.0_scaffold00045.193 322 DVEESVAVLAPMVLRTMLVKPHCLEK----MIRVIRNLCPDIMVLTEVEGKHNSPSFVNRFIEVLFYYS 386
                                               558********************999....*************************************** PP

                                      GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                               a fdsl+a + +++ +r  +E  l++ +++n++a eg er++rh  l +Wr  l+++GF++v++se+a 
  evm_27.model.AmTr_v1.0_scaffold00045.193 387 AYFDSLDAFMEAADPNRLAMEGTLMASAVRNMIAREGGERIMRHVGLDTWRLFLNRVGFEEVEVSEDAL 455
                                               ********************************************************************* PP

                                      GRAS 335 kqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                qakl+++ ++  +  ++e + +sl++gWk+ pL svSaWr
  evm_27.model.AmTr_v1.0_scaffold00045.193 456 YQAKLIVKSYNhAESVSLEMNGKSLTIGWKGTPLHSVSAWR 496
                                               ***********9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098522.17135475IPR005202Transcription factor GRAS
PfamPF035145.1E-28162319IPR005202Transcription factor GRAS
PfamPF035143.4E-44322496IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MDVTFTKLGF HEPETLSGLL MAFQAPEEQS KSTGSSSPIN TPPISGTLND QGKVPIADIL  60
EQTDHGTYPK KETAYPISLA SLEILNSYSN LSRRLSGSSA VKQSTHVDPP IGGEKKLSTE  120
EVMRIAGEQY LTTGENLSSP SIRDSSKLSH LTKEDVKNIE LANLLLSSAE KISNQQYDRA  180
KRLLMVCDFE SSPVGNPVQR LVFHFADALW ERAERETGMK SLKPEYIERE ADVDKALRGY  240
HPVVLAIYQA VPFGKLVQFT ASQVIIGALD SATKIHVIDL EPRTGMQWTI LMQSLSERSE  300
YPVEHLKITM VGDSTGKMEE TDVEESVAVL APMVLRTMLV KPHCLEKMIR VIRNLCPDIM  360
VLTEVEGKHN SPSFVNRFIE VLFYYSAYFD SLDAFMEAAD PNRLAMEGTL MASAVRNMIA  420
REGGERIMRH VGLDTWRLFL NRVGFEEVEV SEDALYQAKL IVKSYNHAES VSLEMNGKSL  480
TIGWKGTPLH SVSAWRCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3419449636375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621963.10.0PREDICTED: scarecrow-like protein 23
TrEMBLW1P3910.0W1P391_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-42RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]