PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00045.122
Common NameAMTR_s00045p00124580, LOC18430143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GeBP
Protein Properties Length: 344aa    MW: 38851.8 Da    PI: 7.8792
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00045.122genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573114.27.8e-3697192197
                                    DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkv 69 
                                               klfqrlw++eDei lL G+ ++ +++g+ +++d++ fy+++k+s++++++k+qlveK+rrLKkK+++ v
  evm_27.model.AmTr_v1.0_scaffold00045.122  97 KLFQRLWTDEDEIGLLNGFYEY-SQKGTGSFHDLTPFYDQIKSSLQLDFNKNQLVEKLRRLKKKYRNVV 164
                                               579*******************.899******************************************* PP

                                    DUF573  70 kkaksgkepsfskehdqkifelskkiWg 97 
                                               +k+  gk++sf+++hdq +fe+skkiW 
  evm_27.model.AmTr_v1.0_scaffold00045.122 165 NKMGAGKDFSFKSPHDQAAFEISKKIWS 192
                                               ***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-3399192IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MAPPSSDEDR NPSEEDLNPS IKTNPSSPMV SPSCSSYSDS PPPLPPPSMP QNGSEKLMTP  60
EEFSASKRKK RRRKIPETPV DCHDSEPEKK LFDDSRKLFQ RLWTDEDEIG LLNGFYEYSQ  120
KGTGSFHDLT PFYDQIKSSL QLDFNKNQLV EKLRRLKKKY RNVVNKMGAG KDFSFKSPHD  180
QAAFEISKKI WSGGFRSVNN KNPSNHEAYG VDSKNLESVE EEERSVPDKK KLKRPRTEDQ  240
SVRDPNGIQA IVEDTVRCCL SPLFKEMFQC AVNVPIHSPG FGLGFNLPPL NGGGLFDGLN  300
LGAQVDERWR KQQILELEVY SKRIELIQDQ IKSTLETLKS AGK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16773RKKRRRK
26873KKRRRK
3227234DKKKLKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840368.10.0probable transcription factor At3g04930
SwissprotF4K5T43e-62STKLU_ARATH; Probable transcription factor At5g28040
TrEMBLW1P2980.0W1P298_AMBTC; Uncharacterized protein
STRINGERN020430.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31841028
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.13e-59DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. GarcĂ­a-Cano E,Hak H,Magori S,Lazarowitz SG,Citovsky V
    The Agrobacterium F-Box Protein Effector VirF Destabilizes the Arabidopsis GLABROUS1 Enhancer/Binding Protein-Like Transcription Factor VFP4, a Transcriptional Activator of Defense Response Genes.
    Mol. Plant Microbe Interact., 2018. 31(5): p. 576-586
    [PMID:29264953]