PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00044.249
Common NameAMTR_s00044p00228020, LOC18445615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 767aa    MW: 83835.5 Da    PI: 6.5433
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00044.249genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS278.22.5e-853977651374
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppse 68 
                                               lv++Ll++Ae v++g++  a+a+Larl+++ sp g+p++R+a+yf++AL + l + + ++  +  ++++
  evm_27.model.AmTr_v1.0_scaffold00044.249 397 LVDQLLKAAELVEAGNAGPARAILARLNHQLSPLGNPLHRAAFYFKQALLSLLCNpQPPHQLSRSSSTP 465
                                               6899**************************************************943344444444444 PP

                                      GRAS  69 tsekn........sseelaalklfsevsPilkfshltaNqaIleavege...ervHiiDfdisqGlQWp 126
                                               +s+++         ++++ a+k+fse++P+ +fs++t+Nqa+le+++ +   + +HiiDf+i+ G+QW 
  evm_27.model.AmTr_v1.0_scaffold00044.249 466 SSSSSfcsanpfeIVHKIGAFKAFSEIFPFSQFSNFTCNQALLESLDDAslsNPIHIIDFEIGFGGQWS 534
                                               444447778888788888888**************************99888999************** PP

                                      GRAS 127 aLlqaLasRp.egpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                                               +++q+La +  + pp  l+iT+v++ ++++  e++ ++e+L +fA+  +++fef ++   ++e+l++ +
  evm_27.model.AmTr_v1.0_scaffold00044.249 535 SFMQELAVKLgSAPPiLLKITAVVP-SAHDPIEMSLVRENLYHFARDSNIHFEFGTV---HFESLDPTA 599
                                               *******99954444799******9.77899*************************8...788888887 PP

                                      GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                                               +        +Vn+ +  hr +   ++      ++L+lvk + Pk+vv +e  +d+ ++sF+++fl +le
  evm_27.model.AmTr_v1.0_scaffold00044.249 600 F----VGGAVVNFPIGAHRSF-PGADFL----SLLRLVKAIHPKIVVSTELPCDRIDASFFQHFLLSLE 659
                                               7....344689*********9.333444....6************************************ PP

                                      GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                                                +s ++dsle+    +    +k+Er++++++i++vv  +++      e+l  Wr  + +aGF p++ls+
  evm_27.model.AmTr_v1.0_scaffold00044.249 660 SFSIFLDSLESA-CLDPGVLAKIERFFVQPKIESVVLSRHR-----IEKLPPWRTLFASAGFAPITLSN 722
                                               *********888.4677999****************98776.....5********************** PP

                                      GRAS 332 kaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                               ++++qa+ ++++v+++g++ve+++  lvl+W++++L+s+SaWr
  evm_27.model.AmTr_v1.0_scaffold00044.249 723 FTESQAQEIMKRVQVEGFHVEKRHSMLVLCWQNKELLSASAWR 765
                                               ******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.82371745IPR005202Transcription factor GRAS
PfamPF035148.8E-83397765IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MKGMPYNLQS QGVQIQVTKD WRKPVAIVCS NSSSEPTSVL DLRRSPSPTS TSTLSSSLGG  60
GSVTPDPVPN SEASGSKREE WVSEFQAMEL PPSSSSAANT HSSHSNSNTK PCLNMEDWEA  120
MLMESASSPA HPIINSGDTG PGSSLMKWIM GEIEEPKLTH FDEPMETGFG DQVLASGFSF  180
PEPINPSLPA VSFPRPSNSP ILSPSSPVKN QNPNPPPNRP PPPFLSPPSP AKNIPPPSPA  240
PPFLSPPLPV KNNAPTSFPL QQSPPSCFSL QNAYLPASTA SANLVVPNPL FYQQQFQQLH  300
LQQMELPPQK MEMVEEKLQL PPHLQSQLFM NQGSGPNSPM GFQNSTTMPR QSPPFFHPLQ  360
SEMALVMNGK QRGACMRGMG GDREESPQQL QQHQLALVDQ LLKAAELVEA GNAGPARAIL  420
ARLNHQLSPL GNPLHRAAFY FKQALLSLLC NPQPPHQLSR SSSTPSSSSS FCSANPFEIV  480
HKIGAFKAFS EIFPFSQFSN FTCNQALLES LDDASLSNPI HIIDFEIGFG GQWSSFMQEL  540
AVKLGSAPPI LLKITAVVPS AHDPIEMSLV RENLYHFARD SNIHFEFGTV HFESLDPTAF  600
VGGAVVNFPI GAHRSFPGAD FLSLLRLVKA IHPKIVVSTE LPCDRIDASF FQHFLLSLES  660
FSIFLDSLES ACLDPGVLAK IERFFVQPKI ESVVLSRHRI EKLPPWRTLF ASAGFAPITL  720
SNFTESQAQE IMKRVQVEGF HVEKRHSMLV LCWQNKELLS ASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-2741076516375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006855813.10.0protein SCARECROW 1
TrEMBLU5D4Y00.0U5D4Y0_AMBTC; Uncharacterized protein
STRINGERN172800.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP17501242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.16e-78GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]