PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00043.33
Common NameAMTR_s00043p00159690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 435aa    MW: 48809 Da    PI: 6.3203
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00043.33genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.21.2e-88394282373
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              ++lLl+c  a++ +d +laq++++ l++ as+ gdp+qRl++ f++AL +r +r +++ ++ +++s  ++
  evm_27.model.AmTr_v1.0_scaffold00043.33  39 EKLLLHCGGALERNDITLAQQIMWVLNNVASSVGDPNQRLTSWFLRALISRASRVCPSAMN-MEASLGAH 107
                                              689***************************************************8888886.55555555 PP

                                     GRAS  72 knsseelaalkl..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                 ++++++++l  ++++ P+  f++ + N aI +a+ +++rvHi+D++is+++QWp+L+++L++Rpeg+
  evm_27.model.AmTr_v1.0_scaffold00043.33 108 VARVRSISVTQLagYVDLLPWQSFGFCASNGAICKAIGSSQRVHILDISISHCMQWPTLIDSLSKRPEGA 177
                                              7788999999999********************************************************* PP

                                     GRAS 140 pslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...............vakrledlel 191
                                              p +R+T+ +   ++    + ++ee+g+rL++fA++ +vpf+f+++               ++  +e+l++
  evm_27.model.AmTr_v1.0_scaffold00043.33 178 PLVRLTVPSTRPHVpplLSMSYEEVGHRLSNFAKSRDVPFDFRMIpfedlpnlrdgvkfhHELLMEQLNP 247
                                              ******999966669998999**********************************9998444489999** PP

                                     GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                                              + L+++ +Eal+Vn++ ++h+l+de + ++  +rde+L+ +++  P++v+vv+++ d++++s+  r++++
  evm_27.model.AmTr_v1.0_scaffold00043.33 248 SVLDLRDDEALVVNCQNSVHYLPDEALGIDPcYRDEFLERIRGFHPTIVTVVDEDYDLGHASLSSRISSC 317
                                              *****************************9999************************************* PP

                                     GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                                              ++y +  fd+le+ lp++s +r  +E+  +g +i+n++a eg +r+er e+  +  +r+++a F +vp+ 
  evm_27.model.AmTr_v1.0_scaffold00043.33 318 FNYLWIPFDALETFLPKDSCQRLEYEAD-IGFKIENIIAFEGLQRTERLESGTRLVQRMKKAQFYSVPFM 386
                                              ****************************.***************************************** PP

                                     GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                              e++ak++k+ll +++  g+ ++ +++ lvl+Wk+++ v+++aW
  evm_27.model.AmTr_v1.0_scaffold00043.33 387 EDTAKEVKRLLDEHA-SGWGMKRDDDMLVLTWKGHNAVFATAW 428
                                              ***************.899************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.15412410IPR005202Transcription factor GRAS
PfamPF035144.0E-8639428IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MKAVPPIPLT PPSSISRNEG PLSRVFKGCL GTLDANCIEK LLLHCGGALE RNDITLAQQI  60
MWVLNNVASS VGDPNQRLTS WFLRALISRA SRVCPSAMNM EASLGAHVAR VRSISVTQLA  120
GYVDLLPWQS FGFCASNGAI CKAIGSSQRV HILDISISHC MQWPTLIDSL SKRPEGAPLV  180
RLTVPSTRPH VPPLLSMSYE EVGHRLSNFA KSRDVPFDFR MIPFEDLPNL RDGVKFHHEL  240
LMEQLNPSVL DLRDDEALVV NCQNSVHYLP DEALGIDPCY RDEFLERIRG FHPTIVTVVD  300
EDYDLGHASL SSRISSCFNY LWIPFDALET FLPKDSCQRL EYEADIGFKI ENIIAFEGLQ  360
RTERLESGTR LVQRMKKAQF YSVPFMEDTA KEVKRLLDEH ASGWGMKRDD DMLVLTWKGH  420
NAVFATAWAP QPFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-531243066474Protein SHORT-ROOT
5b3h_B4e-541243012420Protein SHORT-ROOT
5b3h_E4e-541243012420Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851166.20.0scarecrow-like protein 32
TrEMBLW1PRW40.0W1PRW4_AMBTC; Uncharacterized protein
STRINGERN127470.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-122GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]