Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00043.33
Common NameAMTR_s00043p00159690
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 435aa    MW: 48809 Da    PI: 6.3203
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00043.33genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              ++lLl+c  a++ +d +laq++++ l++ as+ gdp+qRl++ f++AL +r +r +++ ++ +++s  ++
                                              689***************************************************8888886.55555555 PP

                                     GRAS  72 knsseelaalkl..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                 ++++++++l  ++++ P+  f++ + N aI +a+ +++rvHi+D++is+++QWp+L+++L++Rpeg+
                                              7788999999999********************************************************* PP

                                     GRAS 140 pslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...............vakrledlel 191
                                              p +R+T+ +   ++    + ++ee+g+rL++fA++ +vpf+f+++               ++  +e+l++
  evm_27.model.AmTr_v1.0_scaffold00043.33 178 PLVRLTVPSTRPHVpplLSMSYEEVGHRLSNFAKSRDVPFDFRMIpfedlpnlrdgvkfhHELLMEQLNP 247
                                              ******999966669998999**********************************9998444489999** PP

                                     GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                                              + L+++ +Eal+Vn++ ++h+l+de + ++  +rde+L+ +++  P++v+vv+++ d++++s+  r++++
                                              *****************************9999************************************* PP

                                     GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                                              ++y +  fd+le+ lp++s +r  +E+  +g +i+n++a eg +r+er e+  +  +r+++a F +vp+ 
                                              ****************************.***************************************** PP

                                     GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                              e++ak++k+ll +++  g+ ++ +++ lvl+Wk+++ v+++aW
  evm_27.model.AmTr_v1.0_scaffold00043.33 387 EDTAKEVKRLLDEHA-SGWGMKRDDDMLVLTWKGHNAVFATAW 428
                                              ***************.899************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.15412410IPR005202Transcription factor GRAS
PfamPF035144.0E-8639428IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-26384284374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851166.20.0PREDICTED: scarecrow-like protein 32
TrEMBLW1PRW40.0W1PRW4_AMBTC; Uncharacterized protein
STRINGPOPTR_0007s02880.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-122GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089