PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00043.24
Common NameAMTR_s00043p00136400, LOC18440964
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 589aa    MW: 65316.6 Da    PI: 5.7729
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00043.24genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS433.71.4e-1322175882374
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              ++lL+ecA+a+s+++ ++ ++l+++ ++ +s +g+p+qRl ay++e+L ar   s+s +y++l+++e   
  evm_27.model.AmTr_v1.0_scaffold00043.24 217 RDLLIECAKALSQNEIANFERLISEARNAVSISGKPIQRLGAYMLEGLVARQEASGSVIYRSLKCEEPM- 285
                                              689**************************************************************9997. PP

                                     GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpps 141
                                                 +e l++++ ++e++P++kf++++aN aI ea+ +e+ vHiiDf+i qG+QW++L+qaLa+Rp+gpp+
  evm_27.model.AmTr_v1.0_scaffold00043.24 286 PFGKELLSYMHKLYEICPYFKFGYMAANGAIAEAFRTEDWVHIIDFQIAQGTQWVTLIQALAARPSGPPH 355
                                              468999999999********************************************************** PP

                                     GRAS 142 lRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                                              +RiTg+++p s+  + + le +gerL+ + e++g+p+efn+ v     ++ele+L+v+pgEalaVn+ lq
  evm_27.model.AmTr_v1.0_scaffold00043.24 356 VRITGIDDPVSKqaRGKGLEVVGERLKAMSEKFGIPVEFNA-VPVFGPEVELEMLDVRPGEALAVNFTLQ 424
                                              *********99988999************************.688899********************** PP

                                     GRAS 210 lhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                                              lh+++desv+++++rd++L+ vk lsPkv+++ve+e+++n+++Fl rf+e+leyysa+f+s++++l+r+s
  evm_27.model.AmTr_v1.0_scaffold00043.24 425 LHHTPDESVDVRNPRDDLLRRVKALSPKVMTLVEHESNTNTAPFLPRFMETLEYYSAMFESIDVSLARDS 494
                                              ********************************************************************** PP

                                     GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                                              +eri+vE+++l+r+ivn+vaceg++r+erhe l+kWr+rl++aGF+p+pls ++++ +++ll+ ++++ y
  evm_27.model.AmTr_v1.0_scaffold00043.24 495 KERINVEQHCLARDIVNIVACEGRDRIERHELLAKWRSRLMMAGFRPYPLSGYVNSVIRSLLKSYSEN-Y 563
                                              ******************************************************************55.* PP

                                     GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                                              ++ee++g+l+lgWk+r+L+s+SaW+
  evm_27.model.AmTr_v1.0_scaffold00043.24 564 TLEEKDGALLLGWKERNLISASAWQ 588
                                              ************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.479190569IPR005202Transcription factor GRAS
PfamPF035144.7E-130217588IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MDMNELFSYG GDISYAFSTS SSVPSSEWVY GPMKFNIGSS PDSPLSTQFD YDTLSTTLSN  60
SQEQFSSTEN HDRGISPSHN SSLDSESVLQ RSPHTIQDRF QASAGGSTGS SFITPGAASC  120
IRNMKHALLE LESALMAPDD DEEVTNQSKE RKPENTKRRF VASSQAAMRG PPLARSNSKV  180
QKTSHGDPPE KPCIERGGHG DPQPCGHGDS QPCGNVRDLL IECAKALSQN EIANFERLIS  240
EARNAVSISG KPIQRLGAYM LEGLVARQEA SGSVIYRSLK CEEPMPFGKE LLSYMHKLYE  300
ICPYFKFGYM AANGAIAEAF RTEDWVHIID FQIAQGTQWV TLIQALAARP SGPPHVRITG  360
IDDPVSKQAR GKGLEVVGER LKAMSEKFGI PVEFNAVPVF GPEVELEMLD VRPGEALAVN  420
FTLQLHHTPD ESVDVRNPRD DLLRRVKALS PKVMTLVEHE SNTNTAPFLP RFMETLEYYS  480
AMFESIDVSL ARDSKERINV EQHCLARDIV NIVACEGRDR IERHELLAKW RSRLMMAGFR  540
PYPLSGYVNS VIRSLLKSYS ENYTLEEKDG ALLLGWKERN LISASAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-642205888375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851157.10.0scarecrow-like protein 21
RefseqXP_011625873.10.0scarecrow-like protein 21
RefseqXP_020527190.10.0scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLW1PX240.0W1PX24_AMBTC; Uncharacterized protein
STRINGERN127380.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8948915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-177scarecrow-like 5
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]