PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00042.3
Common NameAMTR_s00042p00022530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CPP
Protein Properties Length: 835aa    MW: 92383.5 Da    PI: 6.9519
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00042.3genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.92.1e-13471509341
                                     TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                             k+ C+Ckks+Clk+YCeCfa+g++C+e+C+C +C+N+ e
  evm_27.model.AmTr_v1.0_scaffold00042.3 471 KRCCHCKKSECLKLYCECFASGTFCGETCSCLECFNRPE 509
                                             689*********************************876 PP

2TCR47.82.9e-15555594140
                                     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                             ++k+gCnCkks+C kkYCeC++a++ Cs+ C+C++C+N+ 
  evm_27.model.AmTr_v1.0_scaffold00042.3 555 RHKRGCNCKKSSCTKKYCECYQAKVGCSDGCRCDGCENTF 594
                                             589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.0E-12469510IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.01470595IPR005172CRC domain
PfamPF036387.1E-11472507IPR005172CRC domain
SMARTSM011148.8E-16555596IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.4E-11557593IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MNKIDHNIEE YLAEYVEEET HIIESTQALT IDDNRTHLVV ASTICEIAKV LQGVPAASTS  60
FSLACVPDQK VHMGEEIKRS PVLDKNGKKE EITSSTYGQK NDAEHDGKCS GMVSEETMKQ  120
LVTSSHELEA DTWHNYHLMD CANSTLNSLL SNNGEHGNSA WDCSQSEHFL KFLKLHCVEG  180
QQHHDWHCTP QLLPKSNYDM YIHAAAYPGS KWRVIQNDEL GRECIPVMHK DDSQHQRGMR  240
RRLQLENPEA RGKSLGASCN PWNPPKNASL TSPSPTPVDI DSGSLSHDGR NYIPVSKKQV  300
SMLASPNPSF SMNRTQELNL DNMGKAGNSG NPSMPSGIGL HLNNIGNPVN ATMQFTPHEY  360
CASSGSVLFH SEGPNVDFPS NVVSSVTGNS KMAEHGFRAG RVVADNASLQ SLPLDVKPLY  420
SYLQYLKHSS NPHEIMISVP QGASGLGMEL HISPQMKRRR ATDVLENKDC KRCCHCKKSE  480
CLKLYCECFA SGTFCGETCS CLECFNRPEY EEKCCEKRKS IVIRNPMAFD PKIVMRSTAR  540
PQSTGETNDT SASARHKRGC NCKKSSCTKK YCECYQAKVG CSDGCRCDGC ENTFGKKGFV  600
EVDIEDKNGG FKEPLEEKPE MVEYRNAHQL HPNVSTSTPF SQYSSHGRAL PNSQYLARRH  660
LSSQDHEIFD HPFFHGGPWV SPNGDKVIDM RTPTPLTYLS SQFSSSAGSS DNIKRSSGTQ  720
LRHCDGYLTQ GLCQGVSSPD TPVPCVDKPR TNIGSSQLFE EGTIDMQKNA DFPSKVVKAT  780
SPNQKHISSP HPRLQELGTL DSPSEPRSGR RYICHMGTPF PPLIPESKDE GSEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1847459214120Protein lin-54 homolog
5fd3_B7e-1847459214120Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020521375.10.0uncharacterized protein LOC18431707 isoform X3
TrEMBLW1P6J90.0W1P6J9_AMBTC; Uncharacterized protein
STRINGERN035530.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.17e-53Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]