PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00041.104
Common NameAMTR_s00041p00147950, LOC18441613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 674aa    MW: 73308.2 Da    PI: 4.9053
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00041.104genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix971.7e-3067151187
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               rW++qe+laL+++r++m+ ++r++ lk+plW+evs+k++e+gf+rs+k+Ckek+en++k+yk++keg+ 
  evm_27.model.AmTr_v1.0_scaffold00041.104  67 RWPRQETLALLKVRQDMDAAFRDATLKGPLWQEVSRKLAEQGFNRSAKKCKEKFENVHKYYKRTKEGRA 135
                                               8******************************************************************** PP

                                  trihelix  70 krtsessstcpyfdqlea 87 
                                               +r++++s  +++f+qlea
  evm_27.model.AmTr_v1.0_scaffold00041.104 136 GRQDGKS--YRFFSQLEA 151
                                               *866665..*******85 PP

2trihelix1093e-34405490187
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               rW+k ev+aLi++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++k
  evm_27.model.AmTr_v1.0_scaffold00041.104 405 RWPKAEVHALIQLRSGLESRYQEAGPKGPLWEEISAGMSRLGYNRSAKRCKEKWENINKYFKKVKESNK 473
                                               8******************************************************************** PP

                                  trihelix  70 krtsessstcpyfdqlea 87 
                                               kr +e+ +tcpyf+ql+a
  evm_27.model.AmTr_v1.0_scaffold00041.104 474 KR-PEDAKTCPYFHQLDA 490
                                               *8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.93460124IPR017877Myb-like domain
SMARTSM007173.8E-464126IPR001005SANT/Myb domain
CDDcd122037.24E-2666131No hitNo description
PfamPF138374.6E-2166152No hitNo description
SMARTSM007170.0059289464IPR001005SANT/Myb domain
PROSITE profilePS500907.143398462IPR017877Myb-like domain
CDDcd122037.54E-30404469No hitNo description
PfamPF138374.2E-24404491No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0009414Biological Processresponse to water deprivation
GO:0010090Biological Processtrichome morphogenesis
GO:0010192Biological Processmucilage biosynthetic process
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MQQGGSQYGV SPEVGQFGGL PENASPISSR APSGRNFEEL VGPAGGFADE EALVGGEEGE  60
RGATGNRWPR QETLALLKVR QDMDAAFRDA TLKGPLWQEV SRKLAEQGFN RSAKKCKEKF  120
ENVHKYYKRT KEGRAGRQDG KSYRFFSQLE ALHSSQATPT TSAPPPPQPP PPQNPNPNNP  180
VPLLPSPMAS NPRPQPTPQL QIPKPAADFP ATGISLSSGD SSESDDSEGT ETVAKDSRKR  240
KRSNSADQMT TKMMDFFEGL MKQVMEKQEA MQQKFLETME KREQARMIRE EAWKRQEMAR  300
LAREHELVAQ ERALSASRDA AVISFLQKIT GQTIPIPNPP AGPTVPVAPV PVPVPPPPTV  360
TAIVPTTPNP TRPPNPAPTP PPPPPPAAPA GADQDLSGHE SSSSRWPKAE VHALIQLRSG  420
LESRYQEAGP KGPLWEEISA GMSRLGYNRS AKRCKEKWEN INKYFKKVKE SNKKRPEDAK  480
TCPYFHQLDA LYKKKIFGGG VSSSGAASES GGEVLAIMAA PPPVVASGGG GGGTTTQQVQ  540
NGNGHGNGGG KDGNGGEGNG GNGGSVQTGF YQSGEQSKKP EDIVRELIDL QQQQQQSVMD  600
DYDKLEEPDS DKLDEEEDQD EEEEEEEEEE EEREGNQQEE EEESRKLPFE VQFQRQPSSA  660
SATNPNTFMA MVQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851901.10.0trihelix transcription factor GTL1 isoform X1
TrEMBLW1PYH80.0W1PYH8_AMBTC; Uncharacterized protein
STRINGERN133680.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-50Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]