PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00040.213
Common NameAMTR_s00040p00205710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 186aa    MW: 19879.9 Da    PI: 5.2448
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00040.213genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.12.9e-10150185136
                                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36 
                                               rW++qe+l L+e+r++m+ ++r++  k+plW+ev++
  evm_27.model.AmTr_v1.0_scaffold00040.213 150 RWPRQETLRLLEVRSQMDVKFREATHKGPLWDEVAR 185
                                               8*********************************95 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEIGEQYGQP ELQQFLAVRS RFPAIQNPPE ILGSHGFQYQ ALLSSSFSNE REHQKLINPS  60
EFYGLLGDQL SDVHNQSVVL KAQQMITGTT NNNNSNTNVF SESPSSMCGP SSPSSIAKNH  120
GGGGGGGFGG GVIMGGGGEE GEEGGGGCGR WPRQETLRLL EVRSQMDVKF REATHKGPLW  180
DEVAR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851703.21e-132trihelix transcription factor PTL
TrEMBLW1PZZ11e-132W1PZZ1_AMBTC; Uncharacterized protein
STRINGERN131701e-133(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8402716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10000.17e-14Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]