PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00036.175
Common NameAMTR_s00036p00232310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 182aa    MW: 19885.5 Da    PI: 9.2223
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00036.175genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof129.21.2e-402383262
                                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                              ++++lkcprC+s+ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  evm_27.model.AmTr_v1.0_scaffold00036.175 23 EQQQLKCPRCESMNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKNTKRS 83
                                              7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-282382IPR003851Zinc finger, Dof-type
PfamPF027019.4E-342581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MQDQAQMISD KRALKPQSFI DQEQQQLKCP RCESMNTKFC YYNNYNLSQP RHFCKNCRRY  60
WTKGGALRNI PVGGGSRKNT KRSASSTARP KAVAAPENEP VVGNLAGKLA GIYSGVREEE  120
VKMMEITGSF SSLLNSGERG FWGLPESGDS GAPLMLQNEA WIGAAWGPDL AMYTPGTAGL  180
Q*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626878.11e-133dof zinc finger protein DOF3.1
TrEMBLU5CZ601e-133U5CZ60_AMBTC; Uncharacterized protein
STRINGERN154591e-134(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-40DOF zinc finger protein 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]