PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00036.135
Common NameAMTR_s00036p00212000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 356aa    MW: 38801.6 Da    PI: 7.0018
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00036.135genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS342.76.4e-105235115374
                                      GRAS  15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                               ++l la ++L ++ +lasp g+p  R+aayf  AL++rl++s+ ++y+ lp+ + +   s++ l+a+++
  evm_27.model.AmTr_v1.0_scaffold00036.135   2 DNLDLAASILPEITHLASPFGSPAMRVAAYFSDALQSRLMSSWLGMYAPLPSYALE-PFSQRLLNAFQA 69 
                                               68999*********************************************999997.4689999***** PP

                                      GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspes 152
                                               ++ + P++kfsh+taNqaI++av++ +rvHiiD+di+qGlQWp L++ L++ + +pps+RiTg+gs   
  evm_27.model.AmTr_v1.0_scaffold00036.135  70 YNAILPLVKFSHFTANQAIVQAVSQVSRVHIIDLDIMQGLQWPGLFHLLSTCSTSPPSVRITGFGS--- 135
                                               ******************************************************************... PP

                                      GRAS 153 gskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsle 221
                                                 ++el +tgerL+ f ++lg+ fe++ lv+++ e  +l +L+++ gE+++Vn+v+  h+++d ++s +
  evm_27.model.AmTr_v1.0_scaffold00036.135 136 -CARELAATGERLSVFSASLGLAFEYTGLVCRAGEVRDLARLKLQGGETVIVNWVH--HYMYDVTGSDA 201
                                               .*******************************************************..99999999999 PP

                                      GRAS 222 serdevLklvkslsPkvvvvveqeadh.nsesFlerflealeyysalfdsleaklpreseerikvErel 289
                                                    +Lkl+ s++P+++++veq+++h +++ Fl+rf++al+yysalfd+l +   + +++r+  E+++
  evm_27.model.AmTr_v1.0_scaffold00036.135 202 G----LLKLLHSVKPRLITMVEQDVSHgDGGGFLRRFVNALHYYSALFDALGSMQDSMNQDRNIAEQQV 266
                                               9....**********************8889********************99989999********** PP

                                      GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgs 357
                                               lgrei+n+v   g++r  ++  +e+W + l++ GF+ v+l+ +aa+qa+lll +++ ++gy+v ee g+
  evm_27.model.AmTr_v1.0_scaffold00036.135 267 LGREIKNIVGGGGRKRSGEMV-VERWGAELGKLGFRGVSLRGSAADQARLLLGMYPwQEGYSVVEEGGC 334
                                               ***************999887.9********************************************** PP

                                      GRAS 358 lvlgWkdrpLvsvSaWr 374
                                               l  gWkd +L+++SaW+
  evm_27.model.AmTr_v1.0_scaffold00036.135 335 LRVGWKDLALLTASAWE 351
                                               ****************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.621330IPR005202Transcription factor GRAS
PfamPF035142.2E-1022351IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDNLDLAASI LPEITHLASP FGSPAMRVAA YFSDALQSRL MSSWLGMYAP LPSYALEPFS  60
QRLLNAFQAY NAILPLVKFS HFTANQAIVQ AVSQVSRVHI IDLDIMQGLQ WPGLFHLLST  120
CSTSPPSVRI TGFGSCAREL AATGERLSVF SASLGLAFEY TGLVCRAGEV RDLARLKLQG  180
GETVIVNWVH HYMYDVTGSD AGLLKLLHSV KPRLITMVEQ DVSHGDGGGF LRRFVNALHY  240
YSALFDALGS MQDSMNQDRN IAEQQVLGRE IKNIVGGGGR KRSGEMVVER WGAELGKLGF  300
RGVSLRGSAA DQARLLLGMY PWQEGYSVVE EGGCLRVGWK DLALLTASAW EPCVM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-129235232379Protein SCARECROW
5b3h_D1e-129235232379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006853952.20.0protein SCARECROW
SwissprotQ9AVK41e-127SCR_PEA; Protein SCARECROW
TrEMBLU5CZ150.0U5CZ15_AMBTC; Uncharacterized protein
STRINGERN154190.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-128GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]