PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00033.186
Common NameAMTR_s00033p00212490, LOC18442603
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 301aa    MW: 32619.5 Da    PI: 8.0116
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00033.186genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.25e-402788263
                                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                                              +e+ l+cprCds+ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+sss
  evm_27.model.AmTr_v1.0_scaffold00033.186 27 PEEVLRCPRCDSANTKFCYYNNYSLAQPRHFCKSCRRYWTKGGALRNVPIGGGCRKNKRSSS 88
                                              57889*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252681IPR003851Zinc finger, Dof-type
PfamPF027011.1E-332985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4883185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MQEEHRREMP DKNVSGTAGG NPILRPPEEV LRCPRCDSAN TKFCYYNNYS LAQPRHFCKS  60
CRRYWTKGGA LRNVPIGGGC RKNKRSSSKS PAPPQQPVQK NLTLDQQSST PIAPETLKFL  120
HGLSPSTMDL YQIGLPLSLS HPFMPFAEQP SSLSPTPPSS LDLGAIPLNI MNSSSGSQVQ  180
EQGFFHGGLA SSIESLSCLN ADLHWRLQQQ RWGHFLGGES ESNQRDGGGA GSGGAMVMSS  240
HGAPGQGVDS VKSDMCGFSV RKSGDMNTEW LFENAYTANA SSNGLQTWQD LQLQQYSALP  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852880.10.0dof zinc finger protein DOF5.7
TrEMBLU5CYX10.0U5CYX1_AMBTC; Uncharacterized protein
STRINGERN143470.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-47Dof family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]