PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00030.96
Common NameAMTR_s00030p00156320, LOC18444380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 277aa    MW: 30821.4 Da    PI: 7.9913
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00030.96genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.72.3e-373897362
                                   zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                              ++ +cprC+stntkfCyynnys +qPryfCk+CrryWtkGGalrnvPvGgg+rk+kk +
  evm_27.model.AmTr_v1.0_scaffold00030.96 38 PQSPNCPRCNSTNTKFCYYNNYSHAQPRYFCKTCRRYWTKGGALRNVPVGGGCRKSKKPN 97
                                             56779***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-242895IPR003851Zinc finger, Dof-type
PfamPF027015.3E-324095IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.54195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MNSLEWQQAD LVMVNPLEDV ISSQSKQLGE RKLKAQTPQS PNCPRCNSTN TKFCYYNNYS  60
HAQPRYFCKT CRRYWTKGGA LRNVPVGGGC RKSKKPNSTK ALQKPTLNYS NEPTLSLSKT  120
NHGSPSFPSC YVMQDGNHEF FLPFQGIGYS SGPDLLQESK PSLLMSDFGC RDVTSFMEPN  180
PRPAHLGNLG FQNFGSFLNL SMEGLNGYGY HQGSDRALFS LENPNDSSSR PVDEFNGLQE  240
KMVETVIDPS TQQNGMGVSW HGVQNSGFSE LQSFFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854615.10.0dof zinc finger protein DOF3.7
TrEMBLU5D3V20.0U5D3V2_AMBTC; Uncharacterized protein
STRINGERN160820.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.15e-35Dof family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]