PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00030.95
Common NameAMTR_s00030p00153440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 281aa    MW: 31023.2 Da    PI: 5.3574
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00030.95genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222.1e-381268561
                                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                             a +cprCds ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++s
  evm_27.model.AmTr_v1.0_scaffold00030.95 12 APHCPRCDSPNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGSLRNVPVGGGCRKNRRS 68
                                             568***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30167IPR003851Zinc finger, Dof-type
PfamPF027014.0E-321267IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8351367IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDRRWKGGIE SAPHCPRCDS PNTKFCYYNN YSLTQPRYFC KSCRRYWTKG GSLRNVPVGG  60
GCRKNRRSKP SKVTGNSNPS NRSSESANSG EELMENWPDF SEIPANSEPE NSGASIDLAM  120
VYARFLRPTD TTGNSSSSDS MLQVPDLVSE TPILDPELDI ALDHGKMFRH GNSMDQGILG  180
TQLIGGFDEM KIRDISNSSS SCEYNHGFIS GFNDILWPNY SNNNNVGPLI SSTNCNWQEQ  240
WQQQGPLLDG KEEMGLGGLS PNLMVGNWNS DLATHSFANP *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854614.20.0dof zinc finger protein DOF2.1
TrEMBLU5CS850.0U5CS85_AMBTC; Uncharacterized protein
STRINGERN160810.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-39Dof family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]