PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00030.43
Common NameAMTR_s00030p00099410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 491aa    MW: 55778.4 Da    PI: 4.5708
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00030.43genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS256.97.4e-791274872373
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgd...pmqRlaayfteALaarlarsvselykalppse 68 
                                              ++ Ll+++eav++g+ + a+++L +ls l+ +  +   p++Rl++yft+ L++r++r    +   ++p +
  evm_27.model.AmTr_v1.0_scaffold00030.43 127 TDMLLSAVEAVATGNIQVASTILPKLSSLSPELENgdyPFNRLIFYFTQSLSSRITR----METHVEPGP 192
                                              678**************************654332235*******************....232233333 PP

                                     GRAS  69 tseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                                                     e+l+a++++++++P++kf+h+taNqaIle ++g + +HiiDfdi++G+QWp+L+ +La R+e 
  evm_27.model.AmTr_v1.0_scaffold00030.43 193 I----INESLQAFEVLQDLTPYIKFAHFTANQAILEGTHGVTGIHIIDFDIMEGIQWPPLMVELALRNEA 258
                                              3....78999*********************************************************776 PP

                                     GRAS 139 ppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnl 206
                                                 lRiT++++++++  +  + ++tg+rL +fA+++g+pf+f+ +++ + + +  e L  ++gE+l+Vn+
  evm_27.model.AmTr_v1.0_scaffold00030.43 259 --FLRITAIVDSTQVdrNWASNQTTGRRLGEFANSIGLPFRFDQILVGKANGF--EGL--ETGEVLVVNC 322
                                              ..*********9888877788999********************977777766..555..88******** PP

                                     GRAS 207 vlqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesFlerflealeyysalfdsle 272
                                              ++++ +++      ++ r+++++ v++l+P++vv+v++e     +  s+sF++ f+ea+++y alf+sl 
  evm_27.model.AmTr_v1.0_scaffold00030.43 323 MMHMLHMP---YRNSNSRQTFMEGVRKLKPRMVVLVQEElfsfGKVLSQSFVDFFVEAFQHYHALFESLL 389
                                              ****9999...44445577********************7664455788********************9 PP

                                     GRAS 273 aklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                                              +++p+ s     ++E+++lg++i ++      ++r+   + +     + + GF+  p+s ++ +qakll+
  evm_27.model.AmTr_v1.0_scaffold00030.43 390 NGFPSRSkLGLEMIEAAFLGPRILDCFQWFPLDKRK---KGRLLDYGFLMQGFQVTPMSASNISQAKLLV 456
                                              99999995667899*************999999444...44555678999******************** PP

                                     GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                                + ++ y+v++e+  l l+Wk+rp+++vS W
  evm_27.model.AmTr_v1.0_scaffold00030.43 457 GLFTGN-YEVQHENCRLKLYWKSRPITTVSIW 487
                                              ****77.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.652100469IPR005202Transcription factor GRAS
PfamPF035142.5E-76127487IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
METSSYLPYD FHLQSALSEF MEFEQTHLLL HPKNREFEDI DPLDDILFAP EGPEFPVTDT  60
FDNVFLDFDE NPDFPISDAA PLVASPPFQD HFQSHVEPIT ELNQEESLNF ITEEFHNASN  120
TSGSNLTDML LSAVEAVATG NIQVASTILP KLSSLSPELE NGDYPFNRLI FYFTQSLSSR  180
ITRMETHVEP GPIINESLQA FEVLQDLTPY IKFAHFTANQ AILEGTHGVT GIHIIDFDIM  240
EGIQWPPLMV ELALRNEAFL RITAIVDSTQ VDRNWASNQT TGRRLGEFAN SIGLPFRFDQ  300
ILVGKANGFE GLETGEVLVV NCMMHMLHMP YRNSNSRQTF MEGVRKLKPR MVVLVQEELF  360
SFGKVLSQSF VDFFVEAFQH YHALFESLLN GFPSRSKLGL EMIEAAFLGP RILDCFQWFP  420
LDKRKKGRLL DYGFLMQGFQ VTPMSASNIS QAKLLVGLFT GNYEVQHENC RLKLYWKSRP  480
ITTVSIWFPV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-3713348926380Protein SCARECROW
5b3h_A4e-3713348925379Protein SCARECROW
5b3h_D4e-3713348925379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627169.10.0nodulation-signaling pathway 2 protein
TrEMBLU5D0V10.0U5D0V1_AMBTC; Uncharacterized protein
STRINGERN160290.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8945915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-47GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]