PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00030.34
Common NameAMTR_s00030p00088210, LOC18444316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 614aa    MW: 68432.9 Da    PI: 5.6808
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00030.34genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix99.52.7e-3197181187
                                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                                              rW++qe+laL+++r++m+ ++r++ lk+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++k+g+ +
  evm_27.model.AmTr_v1.0_scaffold00030.34  97 RWPRQETLALLKIRSDMDAAFRDATLKGPLWEDVSRKLAELGYNRSAKKCKEKFENVHKYYKRTKDGRAG 166
                                              8********************************************************************9 PP

                                 trihelix  71 rtsessstcpyfdqlea 87 
                                              r  ++ +t+++f+qlea
  evm_27.model.AmTr_v1.0_scaffold00030.34 167 R--QDGKTYRFFTQLEA 181
                                              8..56667*******85 PP

2trihelix103.51.6e-32397481186
                                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                                              rW+k ev+aLi++r+ +e r+r++  k+plWeevs+ m++ g++rs+k+Ckekwen+nk++kk+ke++kk
  evm_27.model.AmTr_v1.0_scaffold00030.34 397 RWPKAEVHALIKLRSGLEFRYRETGPKGPLWEEVSAGMARLGYSRSAKRCKEKWENINKYFKKVKESDKK 466
                                              8********************************************************************* PP

                                 trihelix  71 rtsessstcpyfdqle 86 
                                              r +++ +tcpyf+qle
  evm_27.model.AmTr_v1.0_scaffold00030.34 467 R-PQDAKTCPYFNQLE 481
                                              8.99999********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002394156IPR001005SANT/Myb domain
CDDcd122032.09E-2796161No hitNo description
PROSITE profilePS500906.7696154IPR017877Myb-like domain
PfamPF138373.3E-2196182No hitNo description
SMARTSM007170.056394456IPR001005SANT/Myb domain
PROSITE profilePS500906.841396454IPR017877Myb-like domain
CDDcd122031.12E-27396461No hitNo description
PfamPF138373.4E-22396483No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MQQGGSQFEL RPPDFSGHMM AISGGGVAGS MTGNIEQALK QKAGESMAEI ASPVNIREKG  60
RSGSGLEELV GQVSGGYGEE EGFGVEERES GGVGGNRWPR QETLALLKIR SDMDAAFRDA  120
TLKGPLWEDV SRKLAELGYN RSAKKCKEKF ENVHKYYKRT KDGRAGRQDG KTYRFFTQLE  180
ALNSNNNNPI PSTNANININ TTTSNNTVVA TAGILAGNQI KATQSTFSTD FPVNQTAGIS  240
FSSGSSSDSG QKNSNSGETH KRKCGKIMAF FENLMKQVIE KQEELQQKFL DTIEKREEER  300
AMREEAWKRQ EMARVSREQE MLAHERALSA SKDAAVIAFL QKFSGQNVQI PTSFPASVPA  360
ANPGTQETQA NEIEYNHDGG VLAREREVVC FEVASSRWPK AEVHALIKLR SGLEFRYRET  420
GPKGPLWEEV SAGMARLGYS RSAKRCKEKW ENINKYFKKV KESDKKRPQD AKTCPYFNQL  480
EELYKKRFKH SIDSNKKNEG EEERPMAILP PVEQMPDSGG GAVRLFQGHE EAKKPEDLMR  540
GIMNSQQKQQ QQEQQESVMD DYDAENLNAT HEDEDDEDDN DGEEDANDKN GGDNTKLSYV  600
SSSREASFMA MVQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854553.10.0trihelix transcription factor GT-2 isoform X1
SwissprotQ391171e-121TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLU5D1D30.0U5D1D3_AMBTC; Uncharacterized protein
STRINGERN160200.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-61Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]