PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00030.108
Common NameAMTR_s00030p00173920, LOC18444392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TALE
Protein Properties Length: 710aa    MW: 78198.1 Da    PI: 7.0141
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00030.108genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094154521954
                                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  evm_27.model.AmTr_v1.0_scaffold00030.108 415 FEHflHPYPKDADKHMLAKQTGLTRSQVSNWFINARVR 452
                                               554459******************************88 PP

2BELL123.21.1e-39278349172
                                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaia 69 
                                               erqe+q+kkakL+ +l+eVd+rY+qy++q++ v+ssFea+aglg+ak Yt+lAl++iSr+FrcL+dai+
  evm_27.model.AmTr_v1.0_scaffold00030.108 278 ERQEVQMKKAKLVAMLDEVDQRYRQYHHQMHLVVSSFEAAAGLGAAKTYTALALQTISRQFRCLRDAIS 346
                                               79******************************************************************* PP

                                      BELL  70 eqi 72 
                                               +qi
  evm_27.model.AmTr_v1.0_scaffold00030.108 347 SQI 349
                                               **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-61210347IPR006563POX domain
PfamPF075262.3E-50215346IPR006563POX domain
PROSITE profilePS5007112.147393456IPR001356Homeobox domain
SMARTSM003892.9E-9396460IPR001356Homeobox domain
CDDcd000863.09E-12396456No hitNo description
SuperFamilySSF466894.71E-17397463IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29399463IPR009057Homeodomain-like
PfamPF059201.5E-18413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MATYYPGTEI QPDNLQTLYL MNPGYVGYAE ATPSANPGNM VLLNHVNGNP LTIGTNLSQN  60
PNQQPQHFIG IPLQGPDPQR QVLTVNPTDI NPNLLASRIS GHHQYNQWRN SGNELTFLQA  120
IDQSQASTNP SQIANMNSSV SLSHHQPVQE ITNSQMGIRR GPMASDQTQQ GALSLSLSSQ  180
QPSNGQFSFH SSGHGVSQSM KQGTVDSVSS NLQGVLMGSK YLKAAQELLD EVVSVGKGVK  240
TDSGKREKSQ VKIGREMAVE GSGAESSGKK GSELSTVERQ EVQMKKAKLV AMLDEVDQRY  300
RQYHHQMHLV VSSFEAAAGL GAAKTYTALA LQTISRQFRC LRDAISSQIK SASKALGEED  360
CLNGGRGEGS RLRYVDHQLR QQRALQQLGM IPHNAWRPQR GLPERSVSVL RAWLFEHFLH  420
PYPKDADKHM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYMEEMREQE QDKGSDEKTS  480
KSEINDDSSM KSGHQENNPT EQNNHLLIPK QDANNEFKSS STSGFSLIKS PGPQDLHERE  540
ALEQGPPKKL MREKISMNLH DTSSLPSIEV DLKSEEANSG EYIKFGDGRQ SREDFGLDDH  600
GGGFGSAYHI GDLGRFGHEQ FAPRFSGNGV SLTLGLPHCD SLSLAGTQQA YLSNPNLQMG  660
RRHELGGEPN DFCSMNTASA TAHSANPYEN LSIQNRKRFA AQLLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16402460563Homeobox protein Meis2
3k2a_B4e-16402460563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854627.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-137BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLU5D0Z50.0U5D0Z5_AMBTC; Uncharacterized protein
STRINGVIT_06s0009g00410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-117BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]