PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00029.28
Common NameAMTR_s00029p00040760, LOC18437545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 242aa    MW: 25827.5 Da    PI: 10.4682
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00029.28genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.42.5e-3849144397
                                      TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                                              +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tg+++++a++
  evm_27.model.AmTr_v1.0_scaffold00029.28  49 VKKAPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGSGTTPANF 118
                                              79******************************************************************88 PP

                                      TCP  73 ceaesssssasnsssg....kaaksaaks 97 
                                              ++a+s    ++   ++    +++++a++ 
  evm_27.model.AmTr_v1.0_scaffold00029.28 119 SSAASATAPKD---INvsfkDHNSQATPA 144
                                              83333333333...232222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.20954108IPR017887Transcription factor TCP subgroup
PfamPF036344.2E-3354142IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MSADGAGNGS LSSSDQQQQQ RQHHHHQSQG AQHHHHQNQG GASSNVLSVK KAPSKDRHSK  60
VDGRGRRIRM PIICAARVFQ LTRELGHKSD GQTIEWLLRQ AEPSIIAATG SGTTPANFSS  120
AASATAPKDI NVSFKDHNSQ ATPAFKDQNT PFLLGKRLRL DDTKDQNAPV APSAGGAAFW  180
ALPSRPESGQ VWSFGPPEIS ANRLGNYLPI GQPLVGQGHL NLLAALSSEP SASGRRDDDH  240
R*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011624621.11e-176transcription factor TCP7
SwissprotQ9FMX21e-63TCP7_ARATH; Transcription factor TCP7
TrEMBLW1PHC61e-175W1PHC6_AMBTC; Uncharacterized protein
STRINGERN093971e-176(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP85141016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-58TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]