PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00026.127
Common NameAMTR_s00026p00233150, LOC18438625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 272aa    MW: 30410.6 Da    PI: 8.0914
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00026.127genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.5e-19130184256
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               rk+ ++tkeq   Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00026.127 130 RKKLRLTKEQSALLEDSFKEHSTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTK 184
                                               788899***********************************************98 PP

2HD-ZIP_I/II126.31.4e-40130219191
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               +kk+rl+keq++lLE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+
  evm_27.model.AmTr_v1.0_scaffold00026.127 130 RKKLRLTKEQSALLEDSFKEHSTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRC 198
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreel 91 
                                               +++l++en+rL+ke +eL+ +l
  evm_27.model.AmTr_v1.0_scaffold00026.127 199 CETLTDENRRLQKELQELK-AL 219
                                               ******************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.459126186IPR001356Homeobox domain
SuperFamilySSF466892.74E-18128194IPR009057Homeodomain-like
SMARTSM003892.9E-16128190IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-18130184IPR009057Homeodomain-like
CDDcd000862.29E-16130187No hitNo description
PfamPF000462.1E-16130184IPR001356Homeobox domain
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PfamPF021833.6E-11186220IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.8E-25186229IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDDFCNTGLV LGLGRGISLE KLPKPEPKRP CFRLDRLFPS PSEPCLTLAL TETPSPGAVP  60
QKIQVRIDVN KAYEESGAPN CSPTGSSVSS FSNLHRELFN GGVKREREQA TEELEVEKRV  120
SDEEEEGNAR KKLRLTKEQS ALLEDSFKEH STLNPKQKQA LAEQLNLRPR QVEVWFQNRR  180
ARTKLKQTEV DCEFLKRCCE TLTDENRRLQ KELQELKALK FASPVYMQLP AATLTMCPSC  240
ERIGAGDAST RSSFAKAAHF FSGPFTHPAA C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178186RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848871.10.0homeobox-leucine zipper protein HAT22
SwissprotP466043e-75HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLW1PKC30.0W1PKC3_AMBTC; Uncharacterized protein
STRINGERN104520.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-63HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]