PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00025.281
Common NameAMTR_s00025p00211830, LOC18440785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 278aa    MW: 31655.8 Da    PI: 4.7507
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00025.281genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix323.1e-1040106269
                                  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                                               Wt  e l L++ + + ee+   g +  ++W+ vs+++    + rs++qC+  we +  +ykkike+e 
  evm_27.model.AmTr_v1.0_scaffold00025.281  40 WTLTEMLILVREVCSAEEECL-GLSVYQKWKIVSENCGVLDVMRSANQCRRQWEMMLSDYKKIKEWEL 106
                                               666666666555555555543.346679**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.5E-838120No hitNo description
PROSITE profilePS500906.4234095IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEEPAEHTPT NRREAHQKKI ESDSIQTISR YTRSRAAPEW TLTEMLILVR EVCSAEEECL  60
GLSVYQKWKI VSENCGVLDV MRSANQCRRQ WEMMLSDYKK IKEWELQSGI GSFWKVNVDQ  120
MKEVVGVLFL FDQELYDLIN ELLTTREAGP NSRADSGSEG LINLADDDGD NEFNSVLTAP  180
KALNKAVRVR STKKPKTTKP PPQARKIDKE HEIAEKLHEN SQAIQEILQR SLAEDPCEKF  240
TEAEINLKRQ QADELVKAFG DLLGSLNQFV ELVEQCD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006850986.10.0trihelix transcription factor ASR3
TrEMBLW1PRA50.0W1PRA5_AMBTC; Uncharacterized protein
STRINGERN125670.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP74821314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.18e-31sequence-specific DNA binding transcription factors
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]