PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.327
Common NameAMTR_s00024p00249550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25390.8 Da    PI: 5.9218
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.327genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.6e-2064118256
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               rk+ ++tkeq + Lee F++n++++ +++eeL+ kl+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00024.327  64 RKKLRLTKEQARLLEESFKENHTLNPKQKEELSIKLNLRSRQVEVWFQNRRARTK 118
                                               78889************************************************98 PP

2HD-ZIP_I/II116.91.1e-3764152190
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               +kk+rl+keq++lLEesF+e+++L+p++K+el+ +L+l+ rqv+vWFqnrRARtk+kq+E+++e+Lkr+
  evm_27.model.AmTr_v1.0_scaffold00024.327  64 RKKLRLTKEQARLLEESFKENHTLNPKQKEELSIKLNLRSRQVEVWFQNRRARTKLKQTEMECEYLKRC 132
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLree 90 
                                               + +l+een+rL++eve+Lr +
  evm_27.model.AmTr_v1.0_scaffold00024.327 133 FGSLTEENKRLQREVEQLR-A 152
                                               ******************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-1948118IPR009057Homeodomain-like
SuperFamilySSF466895.56E-2053121IPR009057Homeodomain-like
PROSITE profilePS5007117.39460120IPR001356Homeobox domain
SMARTSM003898.1E-1762124IPR001356Homeobox domain
CDDcd000867.06E-1763121No hitNo description
PfamPF000463.1E-1764118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PfamPF021831.7E-9120153IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.0E-21120163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MMVVSTSLDL TMAMPGSSAS GTPPTSELLI FPRGFDINEP PYEDARAVSA EEDEESGGGG  60
GPPRKKLRLT KEQARLLEES FKENHTLNPK QKEELSIKLN LRSRQVEVWF QNRRARTKLK  120
QTEMECEYLK RCFGSLTEEN KRLQREVEQL RALRAPPPTV VSLDTRVAFP ASTLTMCPRC  180
ERVSSTALDD NGFASFGHYA INWFSNSFLA LPQLPDLNLK AEDAVV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020526014.11e-128homeobox-leucine zipper protein HOX3
SwissprotQ0JKX15e-75HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH385e-75HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLW1PTF71e-165W1PTF7_AMBTC; Uncharacterized protein
STRINGERN113281e-166(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.15e-52homeobox-leucine zipper protein 17
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]