PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.262
Common NameAMTR_s00024p00236340, LOC18439455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 609aa    MW: 66157.9 Da    PI: 5.1821
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.262genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS147.41.4e-451854332246
                                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                               ++lL  cA a+++++++++++lL  l++las +gdp++Rlaa+ ++ALa+rl + +++l       +++
  evm_27.model.AmTr_v1.0_scaffold00024.262 185 EQLLNPCASAIEARNNARVHHLLFVLRDLASLSGDPNHRLAAHGLRALARRLEQ-QPSLPGPTGFANSE 252
                                               689**************************************************9.55554333333332 PP

                                      GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavege............ervHiiDfdisqGlQWpa 127
                                                        al  f+e+sP++ fsh ++Nqa+ +a+ ++            +++Hi+D+++s+G+QWp+
  evm_27.model.AmTr_v1.0_scaffold00024.262 253 ---PRALHRALLKFHELSPWFSFSHTVCNQALIQALGSSpqgqgsspvdmgSTLHILDIGVSHGIQWPT 318
                                               ...3333344445***********************888777788888777788*************** PP

                                      GRAS 128 LlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                                               +++a+a  ++++ slR+T+v        s  +      rL++fA++++++++++v v k+le+l++e+L
  evm_27.model.AmTr_v1.0_scaffold00024.262 319 FIEAMAR-KAPTMSLRLTVVTGLIVPfaSGPNGDDFPVRLTRFATSFNMKLDIKV-VRKALENLTVEDL 385
                                               *****96.58999******99854437999************************9.7************ PP

                                      GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246
                                                + pgE la++++ +lh++ +++++ ++    +L ++k+l ++ + ++e + 
  evm_27.model.AmTr_v1.0_scaffold00024.262 386 GIFPGERLAICVQSRLHEISENNGDRRK----FLGFLKGLGAEAMFLSEIDG 433
                                               *******************977776666....**************999886 PP

2GRAS42.51.1e-13481603244373
                                      GRAS 244 qeadh..nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhe 310
                                               qe+     ++ F + f+e +e+ + ++ds  +++    + r   Er+l+++e+ ++   +++e      
  evm_27.model.AmTr_v1.0_scaffold00024.262 481 QESGFggKEGGFTRWFSEGVEFLWRFLDSCGVGF----KGRECEERRLIEEEVAEMCFSAERE----WW 541
                                               55444225679**********************7....8899999999999999998888777....78 PP

                                      GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                                ++kW + +++ GF    l+e++++  +  l+k++  g+++  ++g+l l Wk++p+ ++S W
  evm_27.model.AmTr_v1.0_scaffold00024.262 542 GKRKWGDEMRNLGFIGGVLGEEMVEAGRVFLKKYD-SGWEMRGDEGCLSLFWKGQPVSFCSLW 603
                                               99********************************9.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.801158585IPR005202Transcription factor GRAS
PfamPF035144.7E-43185433IPR005202Transcription factor GRAS
PfamPF035143.7E-11481603IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MLANGTPPPL TDGEGSDLLE WLTADRHDPF LPLPSPLPSL DGTVSWCDWE PVELDPNCNG  60
KHRSSTDGDG NGNGSSREVF DGYYGDRDDD GDSDGNGEKV AGIDGSGRNG RKRPNNACSN  120
DQSKRACNGN GKDDFVGERN GSLSPQTGES SEAEITPALA PVTTEAKPKG CGNGKNNGKE  180
SRWAEQLLNP CASAIEARNN ARVHHLLFVL RDLASLSGDP NHRLAAHGLR ALARRLEQQP  240
SLPGPTGFAN SEPRALHRAL LKFHELSPWF SFSHTVCNQA LIQALGSSPQ GQGSSPVDMG  300
STLHILDIGV SHGIQWPTFI EAMARKAPTM SLRLTVVTGL IVPFASGPNG DDFPVRLTRF  360
ATSFNMKLDI KVVRKALENL TVEDLGIFPG ERLAICVQSR LHEISENNGD RRKFLGFLKG  420
LGAEAMFLSE IDGGETGLPD KGIGFKAKET GFRANEIGFD SNETGYAAKE TGPGANGFAS  480
QESGFGGKEG GFTRWFSEGV EFLWRFLDSC GVGFKGRECE ERRLIEEEVA EMCFSAEREW  540
WGKRKWGDEM RNLGFIGGVL GEEMVEAGRV FLKKYDSGWE MRGDEGCLSL FWKGQPVSFC  600
SLWLVPKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-2218160384472Protein SHORT-ROOT
5b3h_B1e-2218160330418Protein SHORT-ROOT
5b3h_E1e-2218160330418Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849682.10.0nodulation-signaling pathway 1 protein
TrEMBLW1PT990.0W1PT99_AMBTC; Uncharacterized protein
STRINGERN112630.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP40821525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.13e-59GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]