PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.119
Common NameAMTR_s00024p00164620, LOC18439308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 306aa    MW: 33978.8 Da    PI: 7.2067
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.119genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-17158212256
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00024.119 158 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 212
                                               778899***********************************************98 PP

2HD-ZIP_I/II124.93.8e-40158248192
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr+
  evm_27.model.AmTr_v1.0_scaffold00024.119 158 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRC 226
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreelk 92 
                                               +++l+een+rL+ke +eLr +lk
  evm_27.model.AmTr_v1.0_scaffold00024.119 227 CETLTEENRRLQKELQELR-ALK 248
                                               ******************9.665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.8E-1033113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.0E-17139215IPR009057Homeodomain-like
SuperFamilySSF466891.03E-17153215IPR009057Homeodomain-like
PROSITE profilePS5007116.73154214IPR001356Homeobox domain
SMARTSM003894.1E-14156218IPR001356Homeobox domain
PfamPF000465.9E-15158212IPR001356Homeobox domain
CDDcd000862.58E-15158215No hitNo description
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
CDDcd146860.00706207246No hitNo description
SMARTSM003401.1E-25214257IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11214248IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MELALGLGDG SQSLVLMERY NSSSSKRSSG NGGLGFQMCL GNEERHPPVQ LDLLPLGPVP  60
RPWPSENGNS EAETRSSGHA ASTRGFDVNL IPSTEDGDEE TAVSSPNSTV SSFQMDFAML  120
PYHNNSSING AKRDNDAVTN DVEGERRGSD EEENGLTRKK LRLSKEQSAY LEESFKEHNT  180
LNPKQKLALA KQLNLRARQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLQKE  240
LQELRALKTA HPFYMHLPAT TLTMCPSCER VASTDNTASN KIPGGGFSHS KPRFYPFSQH  300
KSAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156162TRKKLRL
2206214RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849539.10.0homeobox-leucine zipper protein HOX11
SwissprotQ6YPD01e-83HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLW1PUZ70.0W1PUZ7_AMBTC; Uncharacterized protein
STRINGERN111200.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-65homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]