PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.27
Common NameAMTR_s00021p00057700, LOC18442135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 146aa    MW: 16655.8 Da    PI: 9.1616
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.27genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-374199260
                                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                                             +e++++cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grr++ +
  evm_27.model.AmTr_v1.0_scaffold00021.27 41 PENSVQCPRCKSKETKFCYFNNYNVNQPRHFCRGCQRYWTAGGALRNVPVGAGRRRKMQ 99
                                             67899**************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-244196IPR003851Zinc finger, Dof-type
PfamPF027014.7E-314398IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.684599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MPKESVFKLF GKRIPINSEI EENQLQQREV EESDESRVRR PENSVQCPRC KSKETKFCYF  60
NNYNVNQPRH FCRGCQRYWT AGGALRNVPV GAGRRRKMQH LPQGEVSACG NDGGHVLIGG  120
NLFDQPGFRQ TGSRCSRMVF TFEEP*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852421.11e-104dof zinc finger protein DOF1.5
SwissprotO229671e-36CDF4_ARATH; Cyclic dof factor 4
TrEMBLW1PZP41e-103W1PZP4_AMBTC; Uncharacterized protein
STRINGERN138881e-104(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.15e-35Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  3. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]