PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00019.101
Common NameAMTR_s00019p00124000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Trihelix
Protein Properties Length: 420aa    MW: 48970.6 Da    PI: 9.7351
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00019.101genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix72.47.9e-2381160286
                                  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                                               Wt+ e+l+Li +r+eme+r+ ++ +k  lW+e+++ mr++ f r ++qC++kwe+l   yk+ ++g k 
  evm_27.model.AmTr_v1.0_scaffold00019.101  81 WTRTETLKLISLRSEMESRFAKTGRKSELWDEIASEMRRESFCRDSQQCRDKWEKLTAGYKEARDGVKA 149
                                               *******************************************************************98 PP

                                  trihelix  71 rtsessstcpyfdqle 86 
                                               +     +++p+f++l+
  evm_27.model.AmTr_v1.0_scaffold00019.101 150 K-----EEFPFFQDLD 160
                                               4.....5799**9997 PP

2trihelix673.7e-21310388285
                                  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                                               W++ evl+Li+ar+em +r+ r +++++lW+e s+k++ +g++r  kqC+ekw++l  ++k +++g+++
  evm_27.model.AmTr_v1.0_scaffold00019.101 310 WKRAEVLKLIKARSEMASRFDRCSRRAALWSELSEKLALEGVKRDGKQCREKWDKLMAEFKDVTDGKRR 378
                                               ********************************************************************9 PP

                                  trihelix  71 rtsessstcpyfdql 85 
                                               +  ++s   pyf++l
  evm_27.model.AmTr_v1.0_scaffold00019.101 379 K--DES---PYFQEL 388
                                               4..444...999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.30473137IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.8E-575137IPR009057Homeodomain-like
SMARTSM007170.009377139IPR001005SANT/Myb domain
CDDcd122032.48E-2379144No hitNo description
PfamPF138374.5E-2079161No hitNo description
PROSITE profilePS500908.014302366IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.4E-5306366IPR009057Homeodomain-like
SMARTSM007170.14306368IPR001005SANT/Myb domain
PfamPF138375.6E-17308389No hitNo description
CDDcd122031.79E-18308373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MSSEKSGSLS VEAKQETEAL IKEQDFPAKD QSFLVKERRF PESEQDFPAI EVLPLNIRPP  60
LEREELQVKR EKEHKRRSKN WTRTETLKLI SLRSEMESRF AKTGRKSELW DEIASEMRRE  120
SFCRDSQQCR DKWEKLTAGY KEARDGVKAK EEFPFFQDLD PILSLKAQRK ALMAGIHQST  180
GKSDDEEEET GSPADFPTSF PVKRRKSSER ETLKDFLESL ISRQHRFFVE LLDAMDKREK  240
AREKQRLERE ERWRAEERAH RAAFQNAMIL LTKKLVTEVC KATPLQKSPE NHFPATFSGK  300
NAAKKRSKNW KRAEVLKLIK ARSEMASRFD RCSRRAALWS ELSEKLALEG VKRDGKQCRE  360
KWDKLMAEFK DVTDGKRRKD ESPYFQELLA MAKSSEPPPP LPCTEPEKSR FHDISEPEA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268546.11e-113PREDICTED: trihelix transcription factor GTL1-like
TrEMBLW1PGN00.0W1PGN0_AMBTC; Uncharacterized protein
STRINGERN071330.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1063658
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03680.15e-15Trihelix family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]