PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00017.27
Common NameAMTR_s00017p00075030, LOC18436680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 457aa    MW: 52147 Da    PI: 6.8423
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00017.27genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS321.71.5e-98804521373
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                              lv+lLl++A+a++++d+  a + L++l   +s +gd++qR+aayf+ +Laarl+ + s  ++ +  ++t+
  evm_27.model.AmTr_v1.0_scaffold00017.27  80 LVHLLLKFATAIADNDAIVAFENLTQLYRKVSLKGDSIQRVAAYFADGLAARLLTKESPSFEYIMKEPTP 149
                                              68*****************************************************888888777777776 PP

                                     GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLa.sRp 136
                                                   +e++a+  ++ +sP+++f+h+taNqaIlea+ege   e +H++Dfd+s+GlQWp+L+q+L+  ++
  evm_27.model.AmTr_v1.0_scaffold00017.27 150 ----RDEFMAFIELYRISPLYQFAHFTANQAILEAFEGEqnnEVLHVVDFDLSHGLQWPSLIQSLSqIKN 215
                                              ....688899999*************************9886677*********************5344 PP

                                     GRAS 137 .egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVn 205
                                                 p++l+i g+ +      eel et++rLa+fA+++g++f f+ l    l++ +++++rv ++E++aVn
  evm_27.model.AmTr_v1.0_scaffold00017.27 216 nTRPATLKIIGLCK----TMEELDETEQRLANFAKSCGLDFVFDGL----LQSSRPSDIRVGKNETIAVN 277
                                              35567*********....9**************************8....9999**************** PP

                                     GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                                              l++ l++l  +++++ +    ++k + +l+P ++vvve+ea +ns +Fl rf+e+l+y++alfd+l+  +
  evm_27.model.AmTr_v1.0_scaffold00017.27 278 LMFYLQTLN-STLDILE----LIKSISKLNPSILVVVENEAARNSRTFLSRFMESLHYFAALFDMLNDFM 342
                                              ***999995.7777777....************************************************* PP

                                     GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr... 342
                                              p+ s er ++E+ +lg++i+ +  ce+++ + rhe+le+W+ r+e++GF+ ++ls++  +qaklll+   
  evm_27.model.AmTr_v1.0_scaffold00017.27 343 PSRSFERLSIEKNFLGKQIKRAMNCENES-NFRHEKLETWKGRMERCGFRGINLSDRCLSQAKLLLQikc 411
                                              **************************997.99*********************************98533 PP

                                     GRAS 343 .......kvk.sdgyrveeesg..slvlgWkdrpLvsvSaW 373
                                                     + + + g++v e++g  +l lgW+d+ L+++SaW
  evm_27.model.AmTr_v1.0_scaffold00017.27 412 hcsqlvdMGAgKGGFKVFEREGgrALSLGWQDKHLITASAW 452
                                              333222111223459998775511455************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.12954420IPR005202Transcription factor GRAS
PfamPF035145.2E-9680452IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MKQEEGNLGP LVLSVNTKTW SQMLKNDPLH KIKKRRLDIF DSLEAPVCEG EFNGILQMRE  60
EMIKLGSEDQ EFDYKRGLQL VHLLLKFATA IADNDAIVAF ENLTQLYRKV SLKGDSIQRV  120
AAYFADGLAA RLLTKESPSF EYIMKEPTPR DEFMAFIELY RISPLYQFAH FTANQAILEA  180
FEGEQNNEVL HVVDFDLSHG LQWPSLIQSL SQIKNNTRPA TLKIIGLCKT MEELDETEQR  240
LANFAKSCGL DFVFDGLLQS SRPSDIRVGK NETIAVNLMF YLQTLNSTLD ILELIKSISK  300
LNPSILVVVE NEAARNSRTF LSRFMESLHY FAALFDMLND FMPSRSFERL SIEKNFLGKQ  360
IKRAMNCENE SNFRHEKLET WKGRMERCGF RGINLSDRCL SQAKLLLQIK CHCSQLVDMG  420
AGKGGFKVFE REGGRALSLG WQDKHLITAS AWHCDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-45804534375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846968.10.0PREDICTED: protein SCARECROW
TrEMBLW1PLA30.0W1PLA3_AMBTC; Uncharacterized protein
STRINGPOPTR_0013s11930.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-61RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]