PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00017.13
Common NameAMTR_s00017p00035550, LOC18436658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 500aa    MW: 52155.9 Da    PI: 7.6552
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00017.13genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP132.44.1e-411112163115
                                      TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                                              ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pai+++tgt++++a++
  evm_27.model.AmTr_v1.0_scaffold00017.13 111 VAKRSSKDRHTKVDGRGRRIRMPATCAARVFQLTRELGHKSDGETIEWLLQQAEPAIIAATGTGTIPANF 180
                                              689*****************************************************************99 PP

                                      TCP  73 c.eaesssssasnsssgkaaksaakskksqksaasalnlakesr 115
                                              +  ++s +s +s+  s       a++  +++++   l ++++ +
  evm_27.model.AmTr_v1.0_scaffold00017.13 181 StLNVSLRSGGSSAMS------GASKAAPHHHSF--LGIQHHAS 216
                                              9555555555552222......222222222222..33333211 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-37115211IPR005333Transcription factor, TCP
PROSITE profilePS5136928.418116170IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001047Molecular Functioncore promoter binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MEQGDHVRSK TNSEGGGGGG PSSSTPSSSQ QQQQQQQQQQ QQMVAFDGRG LVVGYRGEPS  60
AKEIPGPFMG SIGPSSTHVE LAMSTKPEPT KPEGSNPGAI VPIQDPSKKL VAKRSSKDRH  120
TKVDGRGRRI RMPATCAARV FQLTRELGHK SDGETIEWLL QQAEPAIIAA TGTGTIPANF  180
STLNVSLRSG GSSAMSGASK AAPHHHSFLG IQHHASARPD WERAEDAARA VHEQSILGFQ  240
HDNLLAAAAA GGDHLTGEPM GGDPGENYVR KRFREDLFKD DGAEAAKPLR GMQSQQQRPP  300
PEAARPVMPA AAMWAVAAAP AAGLSSSPGA FWMLPVSAGA SSPGVMAAAG PSEPIWTFPP  360
SAAGPSTMYR VPAGTSIHLG GSGSLQSGNT IQAPLHFMPR INISGGLAGL ERVGHVPLGS  420
MLGPPGSHNL GLGISDTNLG MLAALNAYNR GSVGSEQQQG GQQQTAQQAM EQVRHHQQQQ  480
QQQQQQGADS GDDHQTSSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846954.10.0transcription factor TCP8
RefseqXP_020524563.10.0transcription factor TCP8
RefseqXP_020524564.10.0transcription factor TCP8
TrEMBLW1PMY60.0W1PMY6_AMBTC; Uncharacterized protein
STRINGERN085350.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP45911023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.15e-54TCP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]