PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00016.45
Common NameAMTR_s00016p00083040, LOC18434321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LFY
Protein Properties Length: 402aa    MW: 45289.8 Da    PI: 7.3789
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00016.45genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY5675.4e-17313741385
                                  FLO_LFY   1 mdpeafsaslfkwdpraaa.aapparlleeaavseap....leaaaaaaarklreleelfkayGvryltv 65 
                                              mdp+ fs++lfkwd+++   a+pp+rll ++a+++ +    ++ a+    ++l +le+lf++yGvry+tv
  evm_27.model.AmTr_v1.0_scaffold00016.45   1 MDPDPFSVTLFKWDHHHHRpAPPPNRLLLQEATATVTppppQTPASFCRPKELGGLEDLFQQYGVRYFTV 70 
                                              9*************6655526677777655544332222223334444444577**************** PP

                                  FLO_LFY  66 akiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrk.... 131
                                              ak++e+Gftv+tLv+m++ee+d++m sl eifr++ll+GeryGik+a+raerrrleeeea++++++    
  evm_27.model.AmTr_v1.0_scaffold00016.45  71 AKMVEMGFTVNTLVNMREEEIDEMMGSLGEIFRWELLMGERYGIKSAIRAERRRLEEEEARQRQQHhqhh 140
                                              *********************************************************7766555554445 PP

                                  FLO_LFY 132 .ll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkr 195
                                               ll       + ++ ldalsqeglseepvqeekeaagsgg+g  ++e+   +         k+    ++r
  evm_27.model.AmTr_v1.0_scaffold00016.45 141 qLLvvgggGGEVNHHLDALSQEGLSEEPVQEEKEAAGSGGGG--QWEASEGK---------KH----RRR 195
                                              433578766677779***********************9999..67655433.........22....222 PP

                                  FLO_LFY 196 kkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlq 265
                                              + +k             +   + ++g++g erqrehPfivtepgevargkknGLDYLf+Ly++Cr+fL+q
  evm_27.model.AmTr_v1.0_scaffold00016.45 196 RATKG------------NVGGDAEEGSSGGERQREHPFIVTEPGEVARGKKNGLDYLFHLYDECRNFLIQ 253
                                              22222............1223445677889**************************************** PP

                                  FLO_LFY 266 vqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGa 335
                                              vq++akerGekcP kvtnqvfr+ak+agas+inkPkmrhYvhCYalhcLdeeasnalrrafkergenvGa
  evm_27.model.AmTr_v1.0_scaffold00016.45 254 VQALAKERGEKCPNKVTNQVFRHAKRAGASHINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGA 323
                                              ********************************************************************** PP

                                  FLO_LFY 336 wrqacykplvaiaar.qgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                                              wrqacy+plva++++ ++wd+da+f++hp L+iWYvPtkLrqLCh++r++ 
  evm_27.model.AmTr_v1.0_scaffold00016.45 324 WRQACYHPLVAMSRHhHAWDVDALFASHPSLAIWYVPTKLRQLCHADRHSV 374
                                              ************986268******************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.2E-1881373IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDPDPFSVTL FKWDHHHHRP APPPNRLLLQ EATATVTPPP PQTPASFCRP KELGGLEDLF  60
QQYGVRYFTV AKMVEMGFTV NTLVNMREEE IDEMMGSLGE IFRWELLMGE RYGIKSAIRA  120
ERRRLEEEEA RQRQQHHQHH QLLVVGGGGG EVNHHLDALS QEGLSEEPVQ EEKEAAGSGG  180
GGQWEASEGK KHRRRRATKG NVGGDAEEGS SGGERQREHP FIVTEPGEVA RGKKNGLDYL  240
FHLYDECRNF LIQVQALAKE RGEKCPNKVT NQVFRHAKRA GASHINKPKM RHYVHCYALH  300
CLDEEASNAL RRAFKERGEN VGAWRQACYH PLVAMSRHHH AWDVDALFAS HPSLAIWYVP  360
TKLRQLCHAD RHSVTNTDGE AHVGAATTAH SHLHHHSIAN C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-962123912180PROTEIN LEAFY
2vy2_A2e-962123912180PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1938720.0KF193872.1 Amborella trichopoda LEAFY-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020522893.10.0floricaula/leafy homolog isoform X1
SwissprotO040641e-173FLLH_POPTR; Floricaula/leafy homolog
TrEMBLW1P8B90.0W1P8B9_AMBTC; Uncharacterized protein
STRINGERN061320.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-94floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  3. Sayou C, et al.
    A promiscuous intermediate underlies the evolution of LEAFY DNA binding specificity.
    Science, 2014. 343(6171): p. 645-8
    [PMID:24436181]