PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00016.178
Common NameAMTR_s00016p00207840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 170aa    MW: 18302.9 Da    PI: 8.4909
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00016.178genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS173.31.9e-53181611151
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 
                                               lv+lLl+cAeav+++d  +a+++L +ls  asp gd+mqR+a+yf+ AL+arl+          +p+++
  evm_27.model.AmTr_v1.0_scaffold00016.178  18 LVHLLLACAEAVAKEDYPAAHRCLLHLSRAASPLGDSMQRVASYFADALSARLSP-------PPSPQPQ 79 
                                               68****************************************************9.......5667777 PP

                                      GRAS  70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                                               +  + +e l++++++++++P++kf+h+taN+aI ea+++e+rvH+iD+di qG QWpa+lqaLa Rp+g
  evm_27.model.AmTr_v1.0_scaffold00016.178  80 PVAHPAELLKIYQILYQACPYIKFAHFTANHAIFEAFASETRVHVIDLDILQGYQWPAFLQALAGRPGG 148
                                               777899*************************************************************** PP

                                      GRAS 139 ppslRiTgvgspe 151
                                               pp lR+Tg ++++
  evm_27.model.AmTr_v1.0_scaffold00016.178 149 PPALRLTGKVHKT 161
                                               ********88855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.3381169IPR005202Transcription factor GRAS
PfamPF035146.4E-5118161IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MNGGGGEGSG SHDSGLQLVH LLLACAEAVA KEDYPAAHRC LLHLSRAASP LGDSMQRVAS  60
YFADALSARL SPPPSPQPQP VAHPAELLKI YQILYQACPY IKFAHFTANH AIFEAFASET  120
RVHVIDLDIL QGYQWPAFLQ ALAGRPGGPP ALRLTGKVHK TLRQQFSRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-372515626164Protein SCARECROW
5b3h_A2e-372515625163Protein SCARECROW
5b3h_D2e-372515625163Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020523030.11e-118DELLA protein RGL1
SwissprotG7L1664e-61RAM1_MEDTR; GRAS family protein RAM1
TrEMBLW1PGQ31e-120W1PGQ3_AMBTC; Uncharacterized protein
STRINGERN062651e-121(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53661322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.17e-38GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]
  3. Pecrix Y, et al.
    Whole-genome landscape of Medicago truncatula symbiotic genes.
    Nat Plants, 2018. 4(12): p. 1017-1025
    [PMID:30397259]