PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00016.177
Common NameAMTR_s00016p00207780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 222aa    MW: 24869.5 Da    PI: 8.0152
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00016.177genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS249.81.1e-762220145374
                                      GRAS 145 TgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrl 213
                                               Tg+gs    + e ++etg+rLa++A++l+vpfef++ va+ le+l++++L  + gEala+n v +lh++
  evm_27.model.AmTr_v1.0_scaffold00016.177   2 TGLGS----QLELVRETGRRLADLAHSLRVPFEFHA-VADPLEELRPRALGRRIGEALAINAVNRLHHV 65 
                                               88888....8999***********************.8******************************* PP

                                      GRAS 214 ldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                                                  +++l      +L l+++  Pk+v++veqea+hns+ Fl rfleal+yysa fdsl+a++p++s +r
  evm_27.model.AmTr_v1.0_scaffold00016.177  66 A--PHALGP----LLALFRDQAPKIVTLVEQEASHNSPYFLSRFLEALHYYSATFDSLDATFPTDSPQR 128
                                               8..777777....******************************************************** PP

                                      GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                                               + vE+++++ ei n+vacega+r+erhe+le+Wr+ +e  GF+ vpls +a++q ++ll+ +  dgyr+
  evm_27.model.AmTr_v1.0_scaffold00016.177 129 ARVEKFIFAAEINNIVACEGAARVERHERLERWRRVMEGKGFRGVPLSANAVNQSRMLLSIYTCDGYRL 197
                                               ********************************************************************* PP

                                      GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                                               +e+ g+l+lgW+drpL++vSaWr
  evm_27.model.AmTr_v1.0_scaffold00016.177 198 NEDAGCLLLGWQDRPLIAVSAWR 220
                                               **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.0171200IPR005202Transcription factor GRAS
PfamPF035143.7E-742220IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MTGLGSQLEL VRETGRRLAD LAHSLRVPFE FHAVADPLEE LRPRALGRRI GEALAINAVN  60
RLHHVAPHAL GPLLALFRDQ APKIVTLVEQ EASHNSPYFL SRFLEALHYY SATFDSLDAT  120
FPTDSPQRAR VEKFIFAAEI NNIVACEGAA RVERHERLER WRRVMEGKGF RGVPLSANAV  180
NQSRMLLSIY TCDGYRLNED AGCLLLGWQD RPLIAVSAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-491219162378Protein SCARECROW
5b3h_A2e-491219161377Protein SCARECROW
5b3h_D2e-491219161377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020523030.11e-158DELLA protein RGL1
SwissprotG7L1661e-116RAM1_MEDTR; GRAS family protein RAM1
TrEMBLW1PEY11e-160W1PEY1_AMBTC; Uncharacterized protein
STRINGERN062641e-161(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53661322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-58RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]
  3. Pecrix Y, et al.
    Whole-genome landscape of Medicago truncatula symbiotic genes.
    Nat Plants, 2018. 4(12): p. 1017-1025
    [PMID:30397259]