PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00012.77
Common NameAMTR_s00012p00140480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 208aa    MW: 23207.6 Da    PI: 6.6803
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00012.77genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS223.41.1e-681194123320
                                     GRAS 123 lQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                                              +QWpaL+qaLa Rp+gpp +R+Tg+g+p++++++ l+++ ++L ++A++l+++fe + +va++l+dle +
  evm_27.model.AmTr_v1.0_scaffold00012.77   1 MQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDHLQQVSWKLGQLADTLRLEFESRGFVARSLADLEAN 70 
                                              8********************************************************************* PP

                                     GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                                              +L+v p E++aVn++++lh+ll+++++l++    vL  v+ l+P++v++veq+a+hn+  F++rf+eal+
  evm_27.model.AmTr_v1.0_scaffold00012.77  71 MLDVTPSEVVAVNSIFELHKLLAQTGALDK----VLARVRALQPQIVTIVEQDANHNRLVFVDRFAEALH 136
                                              **********************99999999....************************************ PP

                                     GRAS 263 yysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                                              yys+lfdsl   +lp+ s++ +++++++lgr+i ++vacega+r+erhe l +W +r++
  evm_27.model.AmTr_v1.0_scaffold00012.77 137 YYSSLFDSLeRCGLPPGSRD-QVMSEVYLGRQIFDIVACEGADRVERHEPLTQWTARMG 194
                                              *********66778887765.6777888*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.7E-661194IPR005202Transcription factor GRAS
PROSITE profilePS5098538.8971207IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MQWPALMQAL ALRPGGPPAF RLTGIGPPQP DNTDHLQQVS WKLGQLADTL RLEFESRGFV  60
ARSLADLEAN MLDVTPSEVV AVNSIFELHK LLAQTGALDK VLARVRALQP QIVTIVEQDA  120
NHNRLVFVDR FAEALHYYSS LFDSLERCGL PPGSRDQVMS EVYLGRQIFD IVACEGADRV  180
ERHEPLTQWT ARMGSRVRAR APRLERV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-261179141311Protein SCARECROW
5b3h_A6e-261179140310Protein SCARECROW
5b3h_D6e-261179140310Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826893.11e-113DELLA protein GAI1
SwissprotQ84TQ74e-98GAI_GOSHI; DELLA protein GAI
TrEMBLW1PJ751e-150W1PJ75_AMBTC; Uncharacterized protein
STRINGERN077891e-150(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-91GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]