PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00012.209
Common NameAMTR_s00012p00239560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 743aa    MW: 84573 Da    PI: 6.0448
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00012.209genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS389.73.2e-1193627351374
                                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 
                                               l++lL++cAeav+++d + +++lL++++++++p+gd  qRla++f+ +L+arl++++s++++a +  ++
  evm_27.model.AmTr_v1.0_scaffold00012.209 362 LRSLLIHCAEAVATDDRRSINELLKQIRQHSTPYGDGCQRLAQCFADGLEARLYGTGSQIFHATSIFNK 430
                                               689*************************************************************99999 PP

                                      GRAS  70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                                               + ++ +++l+a++l++ ++P+ k+sh  aNq+I++ +e+++ +Hi+Df+i +G+QWp+L+q L++Rp+g
  evm_27.model.AmTr_v1.0_scaffold00012.209 431 R-TTAADVLKAYHLYVAACPFKKISHYFANQTIMDVAENASSLHIVDFGIFYGFQWPCLIQRLSTRPGG 498
                                               7.7899*************************************************************** PP

                                      GRAS 139 ppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVn 205
                                               pp+lRiTg++ p +g   +e++ etg+rLa++A++++vpf++n  +a ++e++++e+L+++++++l+Vn
  evm_27.model.AmTr_v1.0_scaffold00012.209 499 PPRLRITGIDFPLPGfrPQERVDETGKRLADYAKSFNVPFQYNS-IACKWENIRIEDLKLDKDDVLVVN 566
                                               ************99999***************************.6999******************** PP

                                      GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                                               + ++l +l+de+v ++s+r+ +L+++++++P+v++++  +  ++++ F++rf ea+ +ysalfd+lea+
  evm_27.model.AmTr_v1.0_scaffold00012.209 567 CLFRLRNLVDETVVVDSPRNIMLNTIRKMNPNVFIHATINGAYSAPFFVTRFREAFFHYSALFDMLEAN 635
                                               ********************************************************************* PP

                                      GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                                               ++re+ +ri +Ere++g+ei nv+aceg er+er et+++W+ r ++aGF +++l+ +++k a+  +++
  evm_27.model.AmTr_v1.0_scaffold00012.209 636 VAREHPQRILIEREIFGKEILNVIACEGVERVERPETYKQWQVRTQRAGFVQLRLNREIVKRARDRVQM 704
                                               ********************************************************************* PP

                                      GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                               ++ + y v+e+ ++++lgWk+r + ++S Wr
  evm_27.model.AmTr_v1.0_scaffold00012.209 705 HYHKDYVVDEDGQWMLLGWKGRIIHALSTWR 735
                                               **888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.36336715IPR005202Transcription factor GRAS
PfamPF035141.1E-116362735IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MDPDLINFSN ILSGFKVDGS LANENVMDLP LLSPEPHVTS QSISSVDGES PEDSEFFSDI  60
VLNYISDMLM EENIEEKPCM YQEGLSFQAT VKPFYDILGE KYPPSPDQPP LYPDLESPEY  120
ASANTEENSN SDTRIRSVTS EDATNSIWDS PDYFHSDNSL KTHLPLRLPV DCNSQVSFTS  180
SSSGSSGTRD GLDESPIYNI TVPEVPNETH RFWQVNRGVE DVKKLLPKGG SLVFGPESNG  240
FGFYASNVNI KVENEENDYR KKEERDDNKR RQKNPHNRDD LGLEEGRSNK QSAIYLERDV  300
RSETFDNVLL CGGGKGRPFS LFQEEALHDG VAKLTLNGTP KGSNSSKSRS KKQSNKKEVV  360
DLRSLLIHCA EAVATDDRRS INELLKQIRQ HSTPYGDGCQ RLAQCFADGL EARLYGTGSQ  420
IFHATSIFNK RTTAADVLKA YHLYVAACPF KKISHYFANQ TIMDVAENAS SLHIVDFGIF  480
YGFQWPCLIQ RLSTRPGGPP RLRITGIDFP LPGFRPQERV DETGKRLADY AKSFNVPFQY  540
NSIACKWENI RIEDLKLDKD DVLVVNCLFR LRNLVDETVV VDSPRNIMLN TIRKMNPNVF  600
IHATINGAYS APFFVTRFRE AFFHYSALFD MLEANVAREH PQRILIEREI FGKEILNVIA  660
CEGVERVERP ETYKQWQVRT QRAGFVQLRL NREIVKRARD RVQMHYHKDY VVDEDGQWML  720
LGWKGRIIHA LSTWRPHARE MY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-573477363379Protein SCARECROW
5b3h_D2e-573477363379Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846246.20.0scarecrow-like protein 33
RefseqXP_020524095.10.0scarecrow-like protein 33
TrEMBLW1PJT00.0W1PJT0_AMBTC; Uncharacterized protein
STRINGERN079210.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]