PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00012.109
Common NameAMTR_s00012p00176640, LOC18436056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 303aa    MW: 32255.8 Da    PI: 8.5792
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00012.109genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3957115462
                                    zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                               +al+cprCdstntkfCyynnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+rknk+++
  evm_27.model.AmTr_v1.0_scaffold00012.109  57 TALRCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRKNKRTK 115
                                               6789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2458108IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3358113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.77659113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MVFTTVPLYI DPPNWPQQEQ EGGQEGTAIG IGTVSVPASA ATAGRARGAR PPASEATALR  60
CPRCDSTNTK FCYYNNYSLS QPRHFCKTCR RYWTRGGALR NVPVGGGCRK NKRTKNNSSN  120
SGSSASSSRP SPQLDHHSAV TTEQLGFPMA IPEFMNANRQ ASGRDFSTTP VELLDMVDFR  180
VQAGQLGQHN FLGFGQGEGL VGLQQQGFYG LEGGEQGYVG ASGLRIRNPL EDVENGFMGA  240
SGFRGRNTGN IPQAAVKLED GRSLGLVAAG LGVQRPDSGS GEQYWNPWTD LSGFTSSTGP  300
LL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846146.10.0dof zinc finger protein DOF5.1
TrEMBLW1PJI40.0W1PJI4_AMBTC; Uncharacterized protein
STRINGERN078210.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.18e-31DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]