PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.496
Common NameAMTR_s00010p00264070, LOC18422296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 477aa    MW: 52026.9 Da    PI: 6.3469
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.496genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.6e-38124185263
                                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                               ++k l+c+rC+s +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+sss
  evm_27.model.AmTr_v1.0_scaffold00010.496 124 PSKLLPCARCNSLETKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKHSSS 185
                                               678899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-28119181IPR003851Zinc finger, Dof-type
PfamPF027017.0E-31127182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.941128182IPR003851Zinc finger, Dof-type
PROSITE patternPS013610130166IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MPAEISDPAI KLFGKTIQVL TKKEIQAKED VRSEGAANDK EFSHNSNSKD NSSTKERTHD  60
HEHEDQEEPG DTGSSSEPKN NPTTNQDTTE SPEQEDPINP QEVGGGEEEN QELGIGQERT  120
NKKPSKLLPC ARCNSLETKF CYYNNYNVNQ PRHFCKSCQR YWTAGGTMRN VPVGAGRRKN  180
KHSSSSHYRQ IPSLTPDGLP TSCSNNYESS HIIQNGVAKP TGTVLSFGSD IPLCESVASV  240
LNLAEHRVAA TRRNGLIKAE EEKPQENGED ISCGSSSLTS TNSMDKEQNR VQFQDPNYAT  300
GFASGYSGAP WPYPWSPVQW STPTIGSPAF CAPSIPLSFY HGSYWGCIPG GWPVPWVANG  360
DGGLTSPTSL SNNSSLNSPT LGKHPRDRNL DNQSKTDSCL WVPKTLRIED SGEAVNSSIW  420
ATLKANKEKV DTISGGGIFK AFHSKGDDKN RSSEASQVLH ANPAALSRSH NFHENF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006827283.10.0cyclic dof factor 1
TrEMBLW1NH690.0W1NH69_AMBTC; Uncharacterized protein
STRINGERM945200.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-67cycling DOF factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]